pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
46

Viv Thomas - Amalia Davis & Alice Klay - Club Love E2

File: ziinwnavithamaali3ole4gljuk.mp4
Size: 2.00 GB
Duration: 35:35
Resolution: 1920x1080
Format: mp4
Description: Horny girlfriends Alice Klay and Amalia Davis are making out fervidly, as episode two of Sandra Shines erotic lesbian series Club Love begins. They pay no attention when their friend Lexi Montana sneaks off to fuck hot bartender Mia De Vil, too wrapped up in their own passion to notice. Alice caresses Amalias beautiful big breasts and sucks her nipples, then tugs her panties aside and starts to lick her shaved pussy. Her pierced tongue and probing fingers drive Amalia to a quivering, quaking orgasm. Now Alice gets naked and perches on the table, long legs spread wide so Amalia can lap at her bare pussy. Her pleasure builds to a powerful climax, all awareness of their public location forgotten
RapidgatorK2S

Girls Way - Freya Parker, Avery Jane & Cami Strella - Straight Seduction Therapy

File: ybbwfnagiwafreavecamnjgioum319.mp4
Size: 805.31 MB
Duration: 41:30
Resolution: 1920x1080
Format: mp4
Description: Long-time lesbian couple Avery Jane and Freya Parker are in a rut, their once-passionate relationship now dull and predictable. During a heated argument, Freya threatens to leave if Avery can't find a way to spice things up. Determined to save their marriage, Avery devises a daring plan to reignite their spark.

The next day, Avery surprises Freya by inviting Cami Strella, a gorgeous but clearly straight woman, over. With a gleam in her eye, Avery proposes a racy challenge to her wife the first one to seduce Cami wins. Despite her initial shock, Freya's competitive spirit takes over, and the couple embarks on a wild, hilarious battle to win over their unsuspecting guest!
RapidgatorK2S

Girls Out West - Lana C & Saskia - Mystery

File: erxjinagiouwelansasusmxycoger.mp4
Size: 1.76 GB
Duration: 30:57
Resolution: 1920x1080
Format: mp4
Description: Join us for this stylised shoot where Det. Saskia is feeling frustrated from this case of a missing toy. It is STUMPING her.

Pulling at her suspender straps, Sucking on Saskias nipples while fingering... Saskia clears the desk and fucks the shit out of her with a strap on!

It seems Lana is more mysterious than Saskia had thought of her
RapidgatorK2S

Taboo Heat - Amiee Cambridge & Melanie Hicks - Step Daughter Has Problems V2 P1

File: mqef9nataheamimelis1qt8tqkp.mp4
Size: 604.99 MB
Duration: 17:02
Resolution: 1920x1080
Format: mp4
Description: Play Therapist-

Melanie Hicks shows up at Ms. Amiee Cambridge's office at school, because she has a parent-teacher conference to discuss how her daughter is acting in school. 'Your step-daughter has tried to fuck several of the teachers, and that's why I called this meeting today,' Ms. Amiee Cambridge explains. Amiee continues, 'We could try a play therapy session.' Amiee tells Melanie to walk over to her and give her a kiss. Amiee and Melanie begin to kiss, and then Amiee suggests that Melanie strip out of her pink floral dress. Melanie throws her dress to the floor, and now she is standing in a green bra and panty set. Melanie helps Amiee strip out of her white blouse and black skirt, revealing a yellow bra with matching panties...

Melanie slowly pulls Amiee's yellow bra down, exposing her big tits to her. Melanie instantly leans down to lick and suck on Amiee's nipples. Melanie sits down on the edge of Amiee's desk, and Amiee helps strip Melanie out of her lingerie. Once Melanie is naked, Amiee leans down and she starts to eat Melanie's pussy out. She continues to eat her pussy out until Melanie cums hard in her mouth! Then, Amiee stands up and she kisses Melanie on the mouth. Then, Amiee and Melanie switch places and Amiee sits down on the edge of her desk with her legs spread. Melanie then eats Amiee's pussy out, until she cums hard! 'Maybe we can call your husband, Luke, in here next time to join us!' Amiee exclaims.
RapidgatorK2S

Evil Angel - Megan Inky & Sophia Burns - Passionate Lesbian Fun

File: wiumgnaevanmegsoperbefzm4vc.mp4
Size: 2.31 GB
Duration: 18:59
Resolution: 1920x1080
Format: mp4
Description: Outrageous, curvaceous American porn starlet Sophia Burns teases in a tight bikini, joining busty, elaborately inked Euro-beauty Megan Inky. After a brief intro, the babes pop a squat poolside, making out to warm up for a heated lesbian show. Sophia worships Megan's melons and eats her pussy. Next, Megan takes a turn on Sophia. Ms. Inky pries apart Ms. Burns' chunky butt cheeks, savoring Sophia's flavor while lewdly rimming her bunghole. Megan shoves a large glass toy into Sophia's slit, thrusting to incite Sophia's incessant whimpering. They switch spots at various points through the action, focusing on each other's twat in this kinky, girl-on-girl romp. Taking a seat outside of the pool, the girls wind up their date with a passionate kiss.
RapidgatorK2S

Julia Ann Live - Richelle Ryan - Cougars In The Wild

File: rvyw6najuanliricryajitcbckbeq.mp4
Size: 1.12 GB
Duration: 15:48
Resolution: 1920x1080
Format: mp4
Description: I invited over my stunning cougar friend Richelle Ryan for some girl on girl fun! She showed up in her beautiful red floral dress looking gorgeous. I couldn't resist bringing her straight to my couch and having my way with her..watch us play with each other in this hot new lesbian scene! This 15 minute video is professionally shot with lots of up amazing up close views. Have fun!
RapidgatorK2S

She Seduced Me - Lana Violet & Marica Hase - Getting Her Off To Get Him Off

File: fwy1xnashsemelanmarlky4zwhrg1.mp4
Size: 2.44 GB
Duration: 42:13
Resolution: 1920x1080
Format: mp4
Description: Member Written Story By LizWheeler Lana violets husband is a famous politician who is about the be brought up on bribery charges! After hiring a private investigator to do some research, Lana discovers that the key witness is a Japanese consulate worker named Marica Hase who is a lesbian....
RapidgatorK2S

Girls Only Porn - Amirah Adara, Ivi Rein & Tiffany Tatum - What About Your Wife P2

File: teozcnagionpoamiivitifues3s14hxs.mp4
Size: 1.43 GB
Duration: 25:13
Resolution: 1920x1080
Format: mp4
Description: Tiffany Tatum and Ivi Rein are still basking in the afterglow of seducing Renato into a threesome. What they dont know is that Renatos wife, Amirah Adara, saw them all in the act. As the girls try to lie their way out of the situation, Amirah informs them that she knows everything. Shes also not mad she just wants in on the action.

Exchanging sultry glances, Tiffany and Ivi agree to Amirahs terms. They begin by enjoying a lesbian makeout session as they demonstrate how they seduced Renato in the first place. Then they invite Amirah to join in and she doesnt hesitate to get have some all-girl fun.

Initially, the girls make out before they mutually decide its Ivis turn to get some first. First Amirah and Tiffany go to work licking and nibbling Ivis hard nips. Then Ivi gets to her knees so she can eat Tiffanys pussy while Amirah feasts on Ivis sweet juices.

Switching up the direction of their pleasure train, Ivi gets on her back so she can have Amirah ride her face. Meanwhile, Tiffany gets busy with her tongue between Ivis thighs. Eventually Amirah leans forward to create a 69 while she and Tiffany tag team Ivis cooch.

Its Amirahs turn to enjoy the full force of Tiffany and Ivis attention. Cradled in Ivis arms, Amirah squeals as she gets a full on pussy fingering. As soon as Amirah comes apart, she slides down onto her back so Tiffany can climb aboard her face.

Ivi and Tiffany give Amiras twat one last double team even as Amirah gives Ivis pussy a final licking. Finally sated, the trio comes together for a three-way kiss as they sample each others flavors from their tongues. Amirah announces that maybe she should marry Ivi and Tiffany instead of Renato.
RapidgatorK2S

All Girl Massage - Kenna James & Erin Everheart - Cheeky Surprise

File: 1hzdcnaalgimakeneriephsn5imio.mp4
Size: 546.73 MB
Duration: 33:31
Resolution: 1920x1080
Format: mp4
Description: Erin Everheart arrives for her regular massage appointment with her usual masseuse, Kenna James, and there are subtly flirty vibes between them. Kenna then asks Erin to get undressed for the massage. Once Erin is undressed and lying on her front with the privacy towel over her butt, Kenna enters the room again and begins the massage.

Kenna gives Erin a sensual massage, and gets permission to roll the privacy towel down little-by-little to massage more of Erin's body. There are hints of Kenna being attracted to Erin's towel-covered butt... and when Kenna gets permission to fully remove the towel, it's revealed that Erin is wearing a butt plug!

Erin admits that she's seen Kenna's attraction towards her butt before, so she wanted to give her a sexy invitation to take things further, starting with an extra cheeky butt massage. Kenna is surprised, but with some encouragement, eagerly agrees.
RapidgatorK2S

Viv Thomas - Mirka & Ella Bonita - Goddess

File: 9kwnfnavithmirellrqmqhybmff.mp4
Size: 1.35 GB
Duration: 23:56
Resolution: 1920x1080
Format: mp4
Description: Cute brunette Mirka is immersed in her painting, while her gorgeous girlfriend Ella Bonita watches her from the bed. As Tora Ness erotic lesbian film Goddess begins, Ella distracts her sweetheart with a tender embrace, unhooking her bra and caressing her beautiful breasts while they kiss passionately. She sucks Mirkas nipples, pulls down her lacy panties and pushes her onto the bed, kissing a trail down to her plump-lipped pussy. Mirka moans with arousal as Ella laps at her juicy sex then she takes control, undressing Ella and flipping her onto her back, sucking her chocolate-brown nipples and rubbing her clit. Spreading Ellas succulent pink folds, Mirka makes her gasp and squirm as she licks her avidly. The lovers go wild, fingerbanging and eating each others pussy to mind-blowing orgasms.
RapidgatorK2S

Lez Be Bad - Nicole Aria & Katrina Colt - A New Way To Nuru

File: 2noxcnalebebanickattujqvv2tau.mp4
Size: 560.05 MB
Duration: 40:08
Resolution: 1920x1080
Format: mp4
Description: One of Nicole Aria's favorite ways to unwind is with a sensual NURU massage. But when she moves to a new town, she's worried that she might not find a parlor that caters to her needs. Fortunately, she does find one, but when she arrives for her first appointment, she's stunned to discover it's less of a massage parlor... and more of a BDSM sex dungeon. Nicole briefly considers leaving altogether, but when she's greeted by her stunning domme masseuse, Katrina Colt, she decides to trust her instincts and try something new. Katrina guides Nicole through a BDSM-fuelled NURU experience unlike any other she's ever experienced, including some slippery anal fisting that drives Nicole wild with pleasure.
RapidgatorK2S

Mommy's Girl - Dee Williams & Melody Marks - A Reflection Of Beauty

File: 6kwfanamogideemelwbybkkyv1c.mp4
Size: 915.66 MB
Duration: 41:18
Resolution: 1920x1080
Format: mp4
Description: Melody Marks is feeling down due to a recent breakup, and doesn't believe she'll find love. Her stepmom, Dee Williams, on the other hand, thinks that Melody is being too hard on herself! In fact, Dee tries to boost Melody's confidence by having Melody look at her own reflection in a full-length mirror.

As Melody does, Dee points out all her gorgeous features, which leads to Dee eventually confessing that SHE is attracted to Melody! This causes sparks to fly as Dee becomes more intimate with Melody in front of the mirror, which leads to a sensual session as they both explore what makes each other truly beautiful.
RapidgatorK2S

Sex Art - Chanel Camryn & Beverly Hillson - Sexual Chemistry

File: aww1unasearchabevhgfojizq1d.mp4
Size: 1.55 GB
Duration: 27:28
Resolution: 1920x1080
Format: mp4
Description: Stunning brunette Chanel Camryn is doing Beverly Hillsons makeup, as Cherry Kiss erotic lesbian film Sexual Chemistry begins. They chat flirtatiously until they cant resist their mutual attraction any longer, and give in to the urge to kiss. Chanel leads cute blonde Beverly to the sofa, sucks her nipples and rubs her through her pink lace panties before tugging them aside and licking her pussy voraciously.

Getting naked, Camryn lies back to receive her share of the oral attention as Beverly nuzzles her fluffy bush and eats her skilfully. Beverly bends over the back of the sofa so her new lover can fingerbang and lick her from behind she reciprocates just as avidly, giving Camryn an intense orgasm. They entwine their legs in scissors and mash their wet pussies together until theyre quivering and moaning in unison.
RapidgatorK2S

Evil Angel - Proxy Paige & Kristy Black - Kinky Lesbian Fun

File: 9e8rvnaevanprokrin7zq33d8zb.mp4
Size: 1.73 GB
Duration: 39:26
Resolution: 1920x1080
Format: mp4
Description: Ass-blessed starlet Kristy Black models a red bikini under a sheer black top, shaking her sweet booty through a sexy tease sequence. The stylish hottie joins buxom, kinky pornographer Proxy Paige for some freaky anal fun. The two are ecstatic to play together on camera for the first time. Proxy playfully jiggles her big boobs in the opening sequence, leading to a candid chat with Kristy. Kristy worships Proxy in front of the camera, caressing the director's ample ass before they whip out the dildos. Each holds her own phallus while lying spread-eagle on the bed, cramming toys into their own buttholes to warm up. Next, Kristy assists Proxy, rimming her bunghole and stretching her sphincter. Proxy does the same for Kristy, wielding a thick prop that perfectly fits into Kristy's gaping colon. The frisky lesbian session serves up epic tit worship, a bevy of different anal toys, and kinky kissing.
RapidgatorK2S

Excogi Girls - Amber & Julia - She's A Valley Girl

File: e9uaxnaexgiambjul1uenmf5voy.mp4
Size: 4.22 GB
Duration: 01:29:04
Resolution: 1920x1080
Format: mp4
Description: Welcome everyone and I just want to say how sorry I am to all those in the Los Angelas area that have lost their livelihoods because of the utter destruction caused by the fires. Shout out to all the brave men and women on the front lines and thank you for doing your jobs in the face of insurmountable odds. What a tragedy and utter failure of the government and the system of California to be so unprepared for what I hate to jump to conclusions could have been mitigated and better handled. My heart goes out to all that lost everything and have to rebuild...

Ok now onto the thing that will hopefully transport us into fantasy land and like totally for sure today we have 19 year old newbie Julia who's a little firecracker and is super excited to have sex with a girl on camera for the first time. We won't count her actual first time licking a friends pussy in the shower that she describes at 142 because according to Julia that was just her and her girlfriend experimenting a little and they were just curious what a girls pussy tasted like. Love this and Amber being the super experienced slit connoisseur is going to teach our newbie the finer arts of the softer side to sex. But as this interview began and progressed and the more Julia opened her mouth and described her love of nature and philosophy of wanting to touch grass of said beautiful nature. The more I just want her to shut the fuck up and start licking Amber Fucking Moore's gorgeous vagina. So after about 10 minutes of the Usual-get-to-know-each-other-mindless-chit-chat, Amber in her so awesomely girly girl way undressed Julia and began to take charge of the situation and thankfully the fun began and we can all rejoice the return of Amber as she so skillfully unclothed Julia and the talking stopped. Now Julia's no church going naive new to sex spring chicken obviously, but what she is new to is her way around a girls body and this becomes evident as the clothes come off and the touching and kissing begins. Amber knows what she's doing and expertly guides Julia through the ropes as she somewhat awkwardly kisses and explores Amber's body. Thank God guys are visual and we want to watch sex and don't need verbal stimulation because watching how surprised Julia is at how fucking good it feels to have an aggressive girl like Amber doing sexual things to her is a sight to behold and Amber is worth every penny we're paying her, and the sex was as they say in the San Fernando Valley, totally awesome. So without further ado I hope you all love these two and until next weeks update I bid you all farewell, cheers. Steve
RapidgatorK2S

A Girl Knows - Natasha Nice & Skylar Snow - My Stepdaughter Caught Us Fucking

File: jqjlenaagiknnatskyqws9endpe2.mp4
Size: 1.67 GB
Duration: 33:11
Resolution: 1920x1080
Format: mp4
Description: Natasha Nice is focused on her work when her stepdaughter, Bianca, interrupts her, asking for something to eat. Natasha, too busy to be bothered, quickly ushers Bianca away. Little does Bianca know, Natasha has a secret loverher assistant, Skylar Snow. As soon as Bianca leaves, Natasha and Skylar share passionate kisses and caress each other's breasts, their desire for each other building. Bianca returns unexpectedly, almost catching the two in the act. Natasha and Skylar quickly move to the kitchen to avoid suspicion but are interrupted again by Bianca. This time, Skylar hides behind the counter and cleverly uses a sex toy on Natasha while Bianca remains oblivious. Once Bianca finally leaves, Natasha and Skylar take their passion to the bedroom for an intense lesbian lovemaking session.
RapidgatorK2S

She Seduced Me - Milana Ricci & Sienna Rae - The Stepfamily Squirt Debacle P1

File: dgnvpnashsememilsieiwwfrdpyyr.mp4
Size: 1.87 GB
Duration: 32:32
Resolution: 1920x1080
Format: mp4
Description: Recent divorcee Sienna Rae has recently remarried to a woman. Eager to embrace her new lesbian relationship, Sienna wants to fulfill her new wifes fantasy of being squirted on. Sienna turns to her only source of information the internet where she finds plenty of squirting videos but no instructions....
RapidgatorK2S

Everything Butt - Rebel Rhyder & Sophia Burns - Foot Fucking Friends

File: wtvafnaevburebsop5rt8d4xzle.mp4
Size: 2.68 GB
Duration: 37:43
Resolution: 1920x1080
Format: mp4
Description: Anal champions Rebel Rhyder and Sophia Burns return to Kink.com to decide which one of them has the more hungry asshole. For starters Rebel is bound to a wooden crate face-down ass-up for Sophias amusement. Sophia plunges her fingers into Rebels welcoming asshole and then her hands. Sophia grabs not one, but two of the biggest dildos on the toy table, then stuffs them both into Rebels gaping butthole. Sophia fucks Rebels rectum with both hands past the wrists for a screaming orgasm finish. Next its Sophias turn to be bound on the box, wrists to ankles, facing up so she can watch everything Rebel does to her ass. Rebel starts with some spanking and ass licking before sliding her hand wrist deep into Sophias equally welcoming asshole. Rebel gets half her forearm into Sophias asshole and uses her guts as a punching bag. Soon Sophia is beyond gaping and blooms her pretty rosebud for Rebel to lick clean. Rebel returns the favor by double fist-fucking Sophias bottomless butthole to an orgasmic finish. Finally both these lovelies are lying on a mattress on the floor, back to back each with a fist up their own asses. But thats not nearly enough for these butt sluts, so Sophia slicks up her foot and slides it into Rebels rump for some sexy foot fucking action. Like a real butt-bestie, Rebel lubes her tootsie and foot-fucks Sophias ass right back. After some pussy-footing around they return to fist-fucking their own asses.
RapidgatorK2S

Viv Thomas - Cherry Candle & Britney Dutch - Pose For Me

File: qwcyunavithchebriznt4yfgfhq.mp4
Size: 1.76 GB
Duration: 30:58
Resolution: 1920x1080
Format: mp4
Description: Cute Britney Dutch arrives for a model casting, as Sandra Shines erotic lesbian film Pose For Me begins. Shes interviewed by sexy redhead Cherry Candle, who asks her to demonstrate some playful poses before moving onto some more provocative ones. Gorgeous Britney isnt shy about stripping down to her panties and high heels, revealing her lovely breasts with kinky pierced nipples. Cherry coaches her in improving her posture, but is taken by surprise when Britney kisses her spontaneously. Delighted, Cherry responds passionately, exposing her beautiful breasts so Britney can suck her nipples, making her gasp and moan. Britney kneels between Cherrys slender thighs, tugs her panties aside and starts to eat her shaved pussy skilfully. Pausing only to undress Cherry to her high heels and push her into an armchair with legs splayed wide, Britney licks her to an intense orgasm. Now Britney straddles Cherrys face to get her share of the oral attention, quivering with arousal as she rides Cherrys talented tongue. Dismounting, she lies back in the armchair and Cherry resumes lapping at her clit, giving her a mind-blowing climax
RapidgatorK2S

Evolved Fights Lez - Cassidy Luxe Vs Vanessa Vega - Orgasm Challenge

File: eqyumnaevfilecasluxvsvanvegxyvporwqkf.mp4
Size: 663.44 MB
Duration: 11:04
Resolution: 1920x1080
Format: mp4
Description: Last Week we saw the incredible sex fight between two competitive sexual gladiators. Now we leave the victory in the hands of the Orgasm. The girl who cums the Most loses. Only one can emerge victorious, but in this game of pleasure, everyone wins. You, the viewer, get to bear witness to the most intense, explosive, and unforgettable orgasm challenge this year. So, sit back, relax, and get ready to be seduced by the unbridled passion of these two sexual gladiators.
RapidgatorK2S

Girls Way - Sheena Ryder & Little Puck - Swapping Phones & Swapping Spit

File: j8koxnagiwashelittktdz4lcx7.mp4
Size: 754.76 MB
Duration: 37:01
Resolution: 1920x1080
Format: mp4
Description: Sheena Ryder receives a sexy text from a stranger and realizes she accidentally swapped phones with her friend, who has met someone at a club. Sheena is amused then confused when she realizes her friend is stalling on hooking up with the hot texter, so decides to impersonate the friend to get with the texter instead!

But when the texter, Little Puck, arrives, things quickly go south when Sheena struggles to keep the act up. Fortunately, when Sheena's finally called out, Little Puck is still interested, which leads to the steamy hookup they both wanted.
RapidgatorK2S

Evil Angel - Megan Inky & Monika Wild - Lesbian Anal Gaping

File: mwqqlnaevanmegmon1nnzgywhyx.mp4
Size: 2.22 GB
Duration: 30:33
Resolution: 1920x1080
Format: mp4
Description: Busty, artfully tattooed Megan Inky teams up with beautiful Monika Wild for an extreme lesbian session. The comely, freaky stars shake their juicy booties poolside in the opening segment, looking fresh in tight bikinis that perfectly highlight their lovely lady lumps. Equipped with large dildos, the girls rim each other's anus. Megan warms Monika up, deeply tonguing her gal-pal's rectum and spanking her plump butt cheeks. Soon, Megan grabs a huge toy to probe Monika's magical sphincter to colossal gaping! They take turns jamming toys into one another's bunghole, and they savor nasty backdoor flavor ass-to-mouth. Spit flows from their lips as they slurp dildos, using the stringy slobber as lube for orifice cramming. This sloppy anal show features pussy eating, decadent girl-girl kissing, and multiple toys for throat fucking!
RapidgatorK2S

Only Tarts - Milka Way & Polly Yangs - For Onlytarts

File: 2vvvwnaontamilpol1vl9zoxoks.mp4
Size: 893.67 MB
Duration: 17:57
Resolution: 1920x1080
Format: mp4
Description: Milka Way and Polly Yangs are the two most popular cheerleaders at their college. Every week they perform in front of thousands of people knowing that most of the men and many of the women watching want to see them naked and have sex with them. Its a secret turn-on for the best friends who prefer to celebrate together after such public displays of their tight young bodies. They love to come in their uniforms and admire one another before getting undressed.

The short skirts and tight tops accentuate their perfect curves and since they both love showing off, they are already super turned on. Undressing one another, they kiss and lick firm breasts and stiff nipples until they can no longer control themselves. Just thinking about all those horny men watching them makes the girls wet. None of those men get to do what these horny besties do. By the time the panties come off, they are soaked all the way through. The only thing left to do is devour one another as the lust rushes over their bodies. Milka loves the way her friends tongue feels on her nipples and between the parted lips of her dripping pussy. She gleefully cums in record time as Polly laps up the sweet juices. Switching places, Milka tongue fucks her best friend until she cant hold back. Knowing how many of the spectators would kill to be with either of them really makes things hotter as they tongue each other to multiple orgasms. This is the very best way to celebrate after the big game. Three cheers for teammates to love eating pussy.
RapidgatorK2S