File: hyqpcnataheamicamrtmrqdevec.mp4
Size: 1.71 GB
Duration: 42:31
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Amiee Cambridge - Slut Landlord Karen Takes BBC Gangbang As Rent
^
X
Loading image...
Home
X
Tag:
Taboo HeatTaboo Heat - Cory Chase & Alexis Fawx - Step Family Breeding 1
File: ed6f3natahecoralewxl1jaibyb.mp4
Size: 2.92 GB
Duration: 58:38
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Cory Chase - Make Up Trip With Step Mom
File: allhdnatahecorchawzmwgxbu1m.mp4
Size: 1.34 GB
Duration: 33:00
Resolution: 1920x1080
Format: mp4
Description: I'm lying down on the hotel bed while my step-mom, Cory Chase, is unpacking our clothes. 'All done unpacking!' she tells me. She is wearing a blue and white dress, but she is about to change into her bikini. She pulls a blue bikini out from the drawer and she walks into the bathroom to avoid changing in front of me. However, instead of changing into her bikini, she wraps a towel around her naked body instead. She walks back into the hotel room and I ask her why she isn't wearing her bathing suit?!
She opens up her towel and she shows me her naked body! 'You can't go down to the pool naked! Go put your bikini on!' I yell. 'I think you and I should have some fun up here first, before we go to the pool,' she offers. She climbs on the bed next to me and she starts to give me a blowjob. She wants to titty fuck my cock, so I move to the edge of the bed where it's easier for her to fuck my cock with her huge tits. I lie down on the bed and Cory climbs on top of me and she starts to ride my cock with her pussy in the cowgirl position. A few minutes later, she flips over into the reverse cowgirl position and she continues to ride my cock with her pussy. We move over to the couch and she lies down in the missionary position while I fuck her. She flips over into the doggystyle position, and I put my cock in her ass hole next. When I pull out, her ass hole is gaped open wide. I fuck her ass and pussy back and forth, and every time I take my cock out of her ass, her hole is gaping open. She moves into the missionary position next, and I continue to fuck her ass and pussy back and forth. When I am finally ready to cum, I have her get down on her knees in front of me and open her mouth wide. I jerk my cock off into her mouth and she swallows it all!
She opens up her towel and she shows me her naked body! 'You can't go down to the pool naked! Go put your bikini on!' I yell. 'I think you and I should have some fun up here first, before we go to the pool,' she offers. She climbs on the bed next to me and she starts to give me a blowjob. She wants to titty fuck my cock, so I move to the edge of the bed where it's easier for her to fuck my cock with her huge tits. I lie down on the bed and Cory climbs on top of me and she starts to ride my cock with her pussy in the cowgirl position. A few minutes later, she flips over into the reverse cowgirl position and she continues to ride my cock with her pussy. We move over to the couch and she lies down in the missionary position while I fuck her. She flips over into the doggystyle position, and I put my cock in her ass hole next. When I pull out, her ass hole is gaped open wide. I fuck her ass and pussy back and forth, and every time I take my cock out of her ass, her hole is gaping open. She moves into the missionary position next, and I continue to fuck her ass and pussy back and forth. When I am finally ready to cum, I have her get down on her knees in front of me and open her mouth wide. I jerk my cock off into her mouth and she swallows it all!
Taboo Heat - Cory Chase & Nala Brooks - Last Portal Search For Step Mom Prime
File: ckr1fnatahecornalrdlar14rbf.mp4
Size: 2.14 GB
Duration: 56:13
Resolution: 1920x1080
Format: mp4
Description: Bliss Trap-
Cory Chase walks past the decoy step-moms that are lying on the ground. Cory is wearing mint green lingerie with a white lab coat on top. 'Let's go find step-mom prime,' she whispers to herself. Cory takes out her portal device and she uses it to open up a portal. Cory is going to travel through different dimensions to find the step-mom prime. When the portal opens, Cory is surrounded by dinosaurs! 'Oops, wrong dimension,' she says. Cory walks back through the portal and she tries again.
'Ah! I finally found you!' she says to the woman sitting outside by the pool. 'I've had to use multiple phony step-moms to keep Luke Longly distracted! I'm glad I finally found you after 5 years!' Cory exclaims. 'All the decoys are exhausted! It's time for you to come home!' Cory says to her. Cory uses her portal device and she takes Nala Brooks back with her to Earth. They walk together into Cory's bedroom, and Nala immediately pushes her down onto the bed. 'I was stuck there for 5 whole years! I'm so happy to be back!' Nala exclaims. 'You're here for Luke, not your step-sister!' Cory reminds her. Nala leans in and kisses her step-sister anyway. Nala pulls Cory's bra off, and then she starts to lick and suck on her nipples. Nala pulls her bikini off as well, and then she starts to rub Cory's clit with her fingers. Cory moves into the doggystyle position and Nala pulls Cory's panties off. Cory lies back down in the missionary position and Nala eats her step-sister's pussy out. After she cums, they switch places and Cory eats Nala's pussy out next until she cums as well. Afterwards, they help each other get dressed. Miss Me?-'Hey step-mom!' I say, as I walk into Nala's bedroom. She is wearing a green bikini, so I ask her if she is about to go to the pool. She ignores my question and she pulls her bikini top to the side, exposing her tits to me. I notice that there is something different about my step-mom today, but I can't put my finger on it. She pulls her bikini bottoms to the side and she reveals her hairy bush. 'I'm so horny today, Luke!' she moans. 'There is something different about you,' I say again. She pulls her bikini off completely, and then she pulls my cock out from under my shorts. She starts to give me a blowjob. She uses her hands and her mouth on my cock at the same time. She wraps her tits around my cock, and she starts to titty fuck my cock next. She lies down on the bed in the missionary position and I start to fuck her pussy. She climbs on top of me and her big tits bounce up and down as she rides me. She moves into the doggystyle position next and I fuck her pussy from behind. 'Can I cum now, step-mom?' I ask her. 'No, you can't cum yet! I have a surprise for you!' she moans. Threesome-'What's the surprise?' I ask my step-mom. She is lying down in the middle of the bed and she is playing with her pussy. My step-Aunt Cory walks out from the bathroom door and she is wearing a white lab coat with turquoise panties and thigh high stockings. A threesome must be my surprise! 'My step-mom looks different for some reason but I can't figure out why,' I tell Cory. 'Have the two of you had fun yet?' Cory asks us. 'We started to, but she wouldn't let me finish! She said that she had a surprise for me first,' I tell Cory. 'Oh, I must be the surprise!' Cory says as she jumps onto the bed and joins my step-mom. Nala starts to lick and suck on Cory's big tits. I climb on to the bed and I join them, where they start to give me a double blowjob. Cory climbs on top of me and she starts to ride my cock. My step-mom licks Cory's nipples while she is riding me. 'I want to taste your pussy on his cock,' my step-mom says. She sucks my cock clean, and then she climbs on top of me and rides my cock in the cowgirl position. While my step-mom is riding me, my step Aunt Cory sucks on her nipples. My step-mom moves into the doggystyle position in front of me, and while I fuck her pussy from behind, she is simultaneously eating my step Aunt Cory's pussy out. Then the two MILF's switch places, and Cory moves into the doggystyle position next. While I am fucking Cory from behind, she is eating my step-mom's pussy out. Then they both move into the missionary position next to each other, and I go back and forth between fucking both of their pussy's. They both flip over into the doggystyle position next to each other, and I continue to fuck both of their pussy's from behind. When I am ready to cum, I pull my cock out of my step-mom's pussy and I jerk my cock off all over my step-mom's face and in her mouth! Step-Mom then moves into the bathroom to clean up. She looks into the mirror and we learn is she really the Step-Mom prime or a decoy herself?!?!
Cory Chase walks past the decoy step-moms that are lying on the ground. Cory is wearing mint green lingerie with a white lab coat on top. 'Let's go find step-mom prime,' she whispers to herself. Cory takes out her portal device and she uses it to open up a portal. Cory is going to travel through different dimensions to find the step-mom prime. When the portal opens, Cory is surrounded by dinosaurs! 'Oops, wrong dimension,' she says. Cory walks back through the portal and she tries again.
'Ah! I finally found you!' she says to the woman sitting outside by the pool. 'I've had to use multiple phony step-moms to keep Luke Longly distracted! I'm glad I finally found you after 5 years!' Cory exclaims. 'All the decoys are exhausted! It's time for you to come home!' Cory says to her. Cory uses her portal device and she takes Nala Brooks back with her to Earth. They walk together into Cory's bedroom, and Nala immediately pushes her down onto the bed. 'I was stuck there for 5 whole years! I'm so happy to be back!' Nala exclaims. 'You're here for Luke, not your step-sister!' Cory reminds her. Nala leans in and kisses her step-sister anyway. Nala pulls Cory's bra off, and then she starts to lick and suck on her nipples. Nala pulls her bikini off as well, and then she starts to rub Cory's clit with her fingers. Cory moves into the doggystyle position and Nala pulls Cory's panties off. Cory lies back down in the missionary position and Nala eats her step-sister's pussy out. After she cums, they switch places and Cory eats Nala's pussy out next until she cums as well. Afterwards, they help each other get dressed. Miss Me?-'Hey step-mom!' I say, as I walk into Nala's bedroom. She is wearing a green bikini, so I ask her if she is about to go to the pool. She ignores my question and she pulls her bikini top to the side, exposing her tits to me. I notice that there is something different about my step-mom today, but I can't put my finger on it. She pulls her bikini bottoms to the side and she reveals her hairy bush. 'I'm so horny today, Luke!' she moans. 'There is something different about you,' I say again. She pulls her bikini off completely, and then she pulls my cock out from under my shorts. She starts to give me a blowjob. She uses her hands and her mouth on my cock at the same time. She wraps her tits around my cock, and she starts to titty fuck my cock next. She lies down on the bed in the missionary position and I start to fuck her pussy. She climbs on top of me and her big tits bounce up and down as she rides me. She moves into the doggystyle position next and I fuck her pussy from behind. 'Can I cum now, step-mom?' I ask her. 'No, you can't cum yet! I have a surprise for you!' she moans. Threesome-'What's the surprise?' I ask my step-mom. She is lying down in the middle of the bed and she is playing with her pussy. My step-Aunt Cory walks out from the bathroom door and she is wearing a white lab coat with turquoise panties and thigh high stockings. A threesome must be my surprise! 'My step-mom looks different for some reason but I can't figure out why,' I tell Cory. 'Have the two of you had fun yet?' Cory asks us. 'We started to, but she wouldn't let me finish! She said that she had a surprise for me first,' I tell Cory. 'Oh, I must be the surprise!' Cory says as she jumps onto the bed and joins my step-mom. Nala starts to lick and suck on Cory's big tits. I climb on to the bed and I join them, where they start to give me a double blowjob. Cory climbs on top of me and she starts to ride my cock. My step-mom licks Cory's nipples while she is riding me. 'I want to taste your pussy on his cock,' my step-mom says. She sucks my cock clean, and then she climbs on top of me and rides my cock in the cowgirl position. While my step-mom is riding me, my step Aunt Cory sucks on her nipples. My step-mom moves into the doggystyle position in front of me, and while I fuck her pussy from behind, she is simultaneously eating my step Aunt Cory's pussy out. Then the two MILF's switch places, and Cory moves into the doggystyle position next. While I am fucking Cory from behind, she is eating my step-mom's pussy out. Then they both move into the missionary position next to each other, and I go back and forth between fucking both of their pussy's. They both flip over into the doggystyle position next to each other, and I continue to fuck both of their pussy's from behind. When I am ready to cum, I pull my cock out of my step-mom's pussy and I jerk my cock off all over my step-mom's face and in her mouth! Step-Mom then moves into the bathroom to clean up. She looks into the mirror and we learn is she really the Step-Mom prime or a decoy herself?!?!
Taboo Heat - Addyson James - Summer With Step Mom 2
File: a6jhwnataheaddjamoqfu38skzz.mp4
Size: 1.94 GB
Duration: 44:57
Resolution: 1920x1080
Format: mp4
Description: Sexy Returns-
I Luke Longly notice a blonde woman standing in the garage next to my car. I walk up behind her and when she turns around, I am surprised to see my step-mom! 'Step-mom! It's been like 2 years since I last saw you,' I gasp. 'I had a great opportunity with my modeling agency, and she also got some enhancements,' she starts to explain. She pulls her top down, exposing her new, huge tits! She tells me that I can touch them, and that's exactly what I do! I tell her that I need to change the oil on my car, and she tells me to change her oil instead! She bends over into the doggystyle position next to my car, and she lifts her dress up, revealing her ass to me...
I move my cock over to where her mouth is, and she starts to give me a blowjob. Then I move back over to where her ass is, and I start to feel her ass up. I fuck her ass from behind, and she starts to moan. I really hope she won't just pack up and leave randomly again! She flips over into the missionary position next, and I love watching her big tits bounce up and down with every thrust. A few minutes later, I pull my cock out of her pussy and I move it into her ass hole. She moves back into the doggystyle position and I continue to fuck her pussy and her ass back and forth. She licks my cock clean, and then I tell her that we will finish what we started later!
Secret Hook Ups-
My step-mom, Addyson James, is in the gym today She is wearing purple leggings with a matching sports bra. She pulls her sports bra down, revealing her big tits. Then she pulls her purple leggings down to the ground. She shakes her ass and then she spreads her ass cheeks apart.
I walk into the gym and I meet my step-mom there. She's put the leggings and sports bra back on, but it doesn't take long for her to pull her big tits out from under the bra. She then pulls her leggings down again, and she shakes her ass in my face. She sits down and she spreads her legs open wide. She starts to give me a blowjob to get my cock nice and hard first. My step-mom tells me that while she was gone for 2 years, she made a lot of exclusive content that she sold online. I tell her that maybe she and I can film some content together sometime too. But for now, us hooking up is a secret. She lies down on her back and I start to fuck her pussy and her ass in the missionary position. Her big tits bounce up and down as I fuck her. Then she flips over into the doggystyle position and I fuck both of her holes from the back. I have to make up for all the lost time! She moves back into the missionary position and I continue to fuck both her ass and pussy. When I am ready to cum, I allow my cock to explode inside of her pussy. Then we watch my cum drip out of her tight pussy. 'Let's get cleaned up before step-dad finds us!' I exclaim.
I Luke Longly notice a blonde woman standing in the garage next to my car. I walk up behind her and when she turns around, I am surprised to see my step-mom! 'Step-mom! It's been like 2 years since I last saw you,' I gasp. 'I had a great opportunity with my modeling agency, and she also got some enhancements,' she starts to explain. She pulls her top down, exposing her new, huge tits! She tells me that I can touch them, and that's exactly what I do! I tell her that I need to change the oil on my car, and she tells me to change her oil instead! She bends over into the doggystyle position next to my car, and she lifts her dress up, revealing her ass to me...
I move my cock over to where her mouth is, and she starts to give me a blowjob. Then I move back over to where her ass is, and I start to feel her ass up. I fuck her ass from behind, and she starts to moan. I really hope she won't just pack up and leave randomly again! She flips over into the missionary position next, and I love watching her big tits bounce up and down with every thrust. A few minutes later, I pull my cock out of her pussy and I move it into her ass hole. She moves back into the doggystyle position and I continue to fuck her pussy and her ass back and forth. She licks my cock clean, and then I tell her that we will finish what we started later!
Secret Hook Ups-
My step-mom, Addyson James, is in the gym today She is wearing purple leggings with a matching sports bra. She pulls her sports bra down, revealing her big tits. Then she pulls her purple leggings down to the ground. She shakes her ass and then she spreads her ass cheeks apart.
I walk into the gym and I meet my step-mom there. She's put the leggings and sports bra back on, but it doesn't take long for her to pull her big tits out from under the bra. She then pulls her leggings down again, and she shakes her ass in my face. She sits down and she spreads her legs open wide. She starts to give me a blowjob to get my cock nice and hard first. My step-mom tells me that while she was gone for 2 years, she made a lot of exclusive content that she sold online. I tell her that maybe she and I can film some content together sometime too. But for now, us hooking up is a secret. She lies down on her back and I start to fuck her pussy and her ass in the missionary position. Her big tits bounce up and down as I fuck her. Then she flips over into the doggystyle position and I fuck both of her holes from the back. I have to make up for all the lost time! She moves back into the missionary position and I continue to fuck both her ass and pussy. When I am ready to cum, I allow my cock to explode inside of her pussy. Then we watch my cum drip out of her tight pussy. 'Let's get cleaned up before step-dad finds us!' I exclaim.
Taboo Heat - Melanie Hicks - Off Season BBC Shower
File: ia3v3natahemelhicx4raxjfqru.mp4
Size: 1.22 GB
Duration: 37:39
Resolution: 1920x1080
Format: mp4
Description: Melanie Hicks sits down in the bathroom and she starts to crack her feet. Then she strips out of her Taboo Heat work uniform and she steps into the shower. She turns the water on and she allows the water to flow all over her body. The water drips down her tits and on to her ass. She lathers soap all over her tits next. Then she rubs soap all over her ass, pussy and legs. She runs the water all over her body, washing the soap away. She steps out of the shower and she begins to dry her body off with a towel when one of the team players, Kaby, walks into the bathroom.
'Oh! I didn't realize anyone was in here!' he gasps. They start to chat about how the basketball season has been going so far. Melanie walks behind him and she starts to give him a massage. 'Hopefully everything will work out for us!' she says. She drops her towel to the ground and she continues to massage his back completely naked. She starts to rub his cock with her hands, on top of his shorts. He licks and sucks on her nipples while she's rubbing his cock. She pulls his shorts down and then she gets down on her knees and starts to suck his cock. She fingers her pussy while his BBC is in her mouth. Once his BBC is nice and hard, Melanie stands up and she leans against the bathroom wall. Kaby Snow starts to fuck her pussy from behind. She lies down on the bench next to the shower, and he continues to fuck her pussy in the missionary position. She sucks his BBC clean, and then he fucks her pussy in the doggystyle position next. Her moans get louder and louder with every thrust of his huge cock. Kaby lies down on the bench, and Melanie rides his cock in the reverse cowgirl position. She flips over into the regular cowgirl position next, and she continues to bounce up and down on his BBC. When he is ready to cum, he pulls his cock out of her pussy and he jerks his cock off into her mouth and onto her chest! 'I'm always here if you wanna relieve any stress!' she tells him. 'I'll keep that in mind,' he responds.
'Oh! I didn't realize anyone was in here!' he gasps. They start to chat about how the basketball season has been going so far. Melanie walks behind him and she starts to give him a massage. 'Hopefully everything will work out for us!' she says. She drops her towel to the ground and she continues to massage his back completely naked. She starts to rub his cock with her hands, on top of his shorts. He licks and sucks on her nipples while she's rubbing his cock. She pulls his shorts down and then she gets down on her knees and starts to suck his cock. She fingers her pussy while his BBC is in her mouth. Once his BBC is nice and hard, Melanie stands up and she leans against the bathroom wall. Kaby Snow starts to fuck her pussy from behind. She lies down on the bench next to the shower, and he continues to fuck her pussy in the missionary position. She sucks his BBC clean, and then he fucks her pussy in the doggystyle position next. Her moans get louder and louder with every thrust of his huge cock. Kaby lies down on the bench, and Melanie rides his cock in the reverse cowgirl position. She flips over into the regular cowgirl position next, and she continues to bounce up and down on his BBC. When he is ready to cum, he pulls his cock out of her pussy and he jerks his cock off into her mouth and onto her chest! 'I'm always here if you wanna relieve any stress!' she tells him. 'I'll keep that in mind,' he responds.
Taboo Heat - Violet Voss & Amiee Cambridge - Milf Science V1
File: mqrmnnatahevioami2lxzmjuvx8.mp4
Size: 2.31 GB
Duration: 55:19
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Cory Chase - Karen Landlord Gets DPd For The Rent
File: z8fhunatahecorcharfzo48m6my.mp4
Size: 1.23 GB
Duration: 30:12
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Cory Chase - Landlord Karen Collection Day 2
File: sqwvtnatahecorchars1ngn4vbe.mp4
Size: 1.09 GB
Duration: 27:10
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Addyson James - BBC Bully
File: bubhenataheaddjaml6kyzmbsyf.mp4
Size: 1.43 GB
Duration: 36:52
Resolution: 1920x1080
Format: mp4
Description: Addyson James is working out in the gym when she stops to grab a quick drink. She is wearing a grey sports bra with red leggings. Detective Don Sudan walks in behind her, and she is stunned! 'Who are you?!' she gasps. 'I'm Detective Sudan baby, who are you?!' he replies. 'I'm Addyson. I'm Cory's step-sister,' she tells him. 'Oh, great! I'm here to collect a debt!' he explains. 'I don't know anything about that,' she says. 'Why don't you give Cory a call and ask her about it?
I will wait right here,' he tells her. Addyson grabs her cell phone and she makes a quick call to Cory. She explains the situation to Cory, and Cory tells her what she has to do. 'Oh, THAT kind of favor? I got it. I will take care of that. Maybe he will even creampie me,' she whispers into the phone. She hangs up the phone and she tells Detective Sudan that she will take care of the favor for him, no problem! He unzips his pants and he pulls his BBC out from under his pants. She gets down on her knees and she starts to give his huge cock a blowjob. His cock is so huge that she uses her hands and her mouth at the same time. She pulls her sports bra down and exposes her huge tits to him Then she continues to suck his cock. Addyson stands up, and the detective pulls her leggings down to the ground. She leans against the desk, and he starts to fuck her pussy from behind. 'Oh yes! Give me that dick!' she moans. He continues to pound his BBC deep inside of her pussy. They walk together over to the other side of the gym, and Addyson lies down on a piece of workout equipment. He continues to fuck her tight pussy in the missionary position. She climbs on top of him next and she rides his BBC in the cowgirl position. A few minutes later, she moves into the reverse cowgirl position. Then she lies back down in the missionary position and the detective moves her on to her side. Then he continues to fuck her pussy harder and harder. She moves back into the missionary position and her moans get louder. She sucks his cock clean, and then he goes back to fucking her pussy in the missionary position. When he is ready to cum, he explodes inside of her pussy and he creampie's her just like she was hoping for!
I will wait right here,' he tells her. Addyson grabs her cell phone and she makes a quick call to Cory. She explains the situation to Cory, and Cory tells her what she has to do. 'Oh, THAT kind of favor? I got it. I will take care of that. Maybe he will even creampie me,' she whispers into the phone. She hangs up the phone and she tells Detective Sudan that she will take care of the favor for him, no problem! He unzips his pants and he pulls his BBC out from under his pants. She gets down on her knees and she starts to give his huge cock a blowjob. His cock is so huge that she uses her hands and her mouth at the same time. She pulls her sports bra down and exposes her huge tits to him Then she continues to suck his cock. Addyson stands up, and the detective pulls her leggings down to the ground. She leans against the desk, and he starts to fuck her pussy from behind. 'Oh yes! Give me that dick!' she moans. He continues to pound his BBC deep inside of her pussy. They walk together over to the other side of the gym, and Addyson lies down on a piece of workout equipment. He continues to fuck her tight pussy in the missionary position. She climbs on top of him next and she rides his BBC in the cowgirl position. A few minutes later, she moves into the reverse cowgirl position. Then she lies back down in the missionary position and the detective moves her on to her side. Then he continues to fuck her pussy harder and harder. She moves back into the missionary position and her moans get louder. She sucks his cock clean, and then he goes back to fucking her pussy in the missionary position. When he is ready to cum, he explodes inside of her pussy and he creampie's her just like she was hoping for!
Taboo Heat - Amiee Cambridge & Koda Monroe - Busty Neighbor Takes My Virginity
File: kzhlinataheamikodptp9wr3ylr.mp4
Size: 2.06 GB
Duration: 53:20
Resolution: 1920x1080
Format: mp4
Description: Filthy Request-
My Luke Longly step-mom, Amiee Cambridge, and our busty next door neighbor, Koda Monroe, are standing next to each other in the kitchen. Koda is wearing purple lingerie while my step-mom is wearing gold lingerie. 'You want me to go fuck your step-son, Luke?!' Koda says to Amiee.
'He's old enough to be out there fucking women, but he is painfully shy! I would really like to do something special for him,' Amiee tells Koda. Amiee starts to rub her hands along Koda's body, especially her tits. Koda sits down on the chair and Amiee pulls our neighbor's tits out from under her top. Then Amiee pulls our neighbor's panties to the side, and she starts to eat her pussy out. 'I want you to ride his cock in the doggy position, and in missionary,' Amiee tells Koda, while she continues to lick her pussy. 'Maybe I will watch you guys fuck through the window, and I'll touch myself,' Amiee exclaims. 'It's your turn now! I want to taste you,' Koda says to Amiee. The two MILF's switch places and Amiee sits down on the chair this time. Koda pulls Amiee's panties off, and her top to the side, so that her pussy and her tits are exposed now. Koda starts to eat Amiee's pussy out until she cums in her mouth. 'Luke's out there by the pool. Go get him!' Amiee tells our neighbor.
Pool Strip First Fuck-
Amiee is staring out the window with her hand down her panties. She is rubbing her own clit with one hand and she is feeling up her own tits with the other. Amiee is watching me as I sit outside by the pool. Koda walks up to me and she starts to strip out of her purple lingerie. She shakes her ass and her tits in my face. Then she sits down next to me, and she starts to give me a blowjob. I rub her clit and then I play with her tits. After she sucks my cock for a few minutes, she moves into the doggystyle position and I fuck her pussy from behind. 'You're doing such a good job!' she moans. A few minutes later, she flips over into the missionary position and we continue to fuck outdoors next to the pool. Her big tits bounce up and down as I thrust my cock deep inside of her pussy. My step-mom, Amiee, walks outside while I am fucking our neighbor! 'Step-mom! I'm sorry! She was doing a sexy strip tease and one thing turned into another,' I confess. 'I know, honey. I was watching you guys through the window,' Amiee admits. 'I like to watch, but I'd also like to join in,' she continues. Amiee pulls her top to the side, exposing her big tits to us. Amiee sits down next to Koda and she starts to make out with her. 'I'm joining you guys!' Amiee exclaims. I continue to fuck Koda's pussy while my step-mom watches. 'It's getting pretty hot out here. Let's finish this inside!' I suggest. The three of us walk together into the house.
Threesome and Bedroom Facial-
Amiee and Koda follow me into the house and into the bedroom. We are about to get started when Amiee notices a car pulling into our driveway. 'Let me go see who that is,' Amiee says. She walks away and Koda and I decide to get started without her. Koda lies down on the bed in the missionary position and she starts to rub her clit to get herself wet. Then I slowly start to fuck her pussy while she's lying on her back. While I am fucking her pussy, my step-mom walks back into the room. Amiee licks and sucks on Koda's big tits while I'm fucking Koda. 'Don't you just love these big tits, Luke?!' Amiee moans while she licks her nipples. Koda moves into the doggystyle position and I fuck her pussy from behind. 'Pound your cock straight into her pussy!' Amiee demands while she sits next to us, watching. 'Bring your ass next to hers,' I tell my step-mom. Amiee moves into the doggystyle position next to Koda, and they start to kiss while I'm fucking Koda from behind. I move my cock over to Amiee's pussy next. I move back and forth between both of their pussy's, and Amiee tells Koda that she takes my cock so well. A few minutes later, they both flip over into the missionary position and I continue to fuck both of their pussy's back and forth. Both of their tits bounce up and down while I fuck them. I take my cock out of Amiee's pussy and she puts it in her mouth again. She licks and sucks all of her pussy juice off of my cock. I fuck Koda's pussy in the missionary position until I am ready to cum. Then, I jerk my cock off into Koda's mouth and all over her face! 'Step-mom, are you sure you're okay with this?!' I ask. 'Yes!' Amiee exclaims.
My Luke Longly step-mom, Amiee Cambridge, and our busty next door neighbor, Koda Monroe, are standing next to each other in the kitchen. Koda is wearing purple lingerie while my step-mom is wearing gold lingerie. 'You want me to go fuck your step-son, Luke?!' Koda says to Amiee.
'He's old enough to be out there fucking women, but he is painfully shy! I would really like to do something special for him,' Amiee tells Koda. Amiee starts to rub her hands along Koda's body, especially her tits. Koda sits down on the chair and Amiee pulls our neighbor's tits out from under her top. Then Amiee pulls our neighbor's panties to the side, and she starts to eat her pussy out. 'I want you to ride his cock in the doggy position, and in missionary,' Amiee tells Koda, while she continues to lick her pussy. 'Maybe I will watch you guys fuck through the window, and I'll touch myself,' Amiee exclaims. 'It's your turn now! I want to taste you,' Koda says to Amiee. The two MILF's switch places and Amiee sits down on the chair this time. Koda pulls Amiee's panties off, and her top to the side, so that her pussy and her tits are exposed now. Koda starts to eat Amiee's pussy out until she cums in her mouth. 'Luke's out there by the pool. Go get him!' Amiee tells our neighbor.
Pool Strip First Fuck-
Amiee is staring out the window with her hand down her panties. She is rubbing her own clit with one hand and she is feeling up her own tits with the other. Amiee is watching me as I sit outside by the pool. Koda walks up to me and she starts to strip out of her purple lingerie. She shakes her ass and her tits in my face. Then she sits down next to me, and she starts to give me a blowjob. I rub her clit and then I play with her tits. After she sucks my cock for a few minutes, she moves into the doggystyle position and I fuck her pussy from behind. 'You're doing such a good job!' she moans. A few minutes later, she flips over into the missionary position and we continue to fuck outdoors next to the pool. Her big tits bounce up and down as I thrust my cock deep inside of her pussy. My step-mom, Amiee, walks outside while I am fucking our neighbor! 'Step-mom! I'm sorry! She was doing a sexy strip tease and one thing turned into another,' I confess. 'I know, honey. I was watching you guys through the window,' Amiee admits. 'I like to watch, but I'd also like to join in,' she continues. Amiee pulls her top to the side, exposing her big tits to us. Amiee sits down next to Koda and she starts to make out with her. 'I'm joining you guys!' Amiee exclaims. I continue to fuck Koda's pussy while my step-mom watches. 'It's getting pretty hot out here. Let's finish this inside!' I suggest. The three of us walk together into the house.
Threesome and Bedroom Facial-
Amiee and Koda follow me into the house and into the bedroom. We are about to get started when Amiee notices a car pulling into our driveway. 'Let me go see who that is,' Amiee says. She walks away and Koda and I decide to get started without her. Koda lies down on the bed in the missionary position and she starts to rub her clit to get herself wet. Then I slowly start to fuck her pussy while she's lying on her back. While I am fucking her pussy, my step-mom walks back into the room. Amiee licks and sucks on Koda's big tits while I'm fucking Koda. 'Don't you just love these big tits, Luke?!' Amiee moans while she licks her nipples. Koda moves into the doggystyle position and I fuck her pussy from behind. 'Pound your cock straight into her pussy!' Amiee demands while she sits next to us, watching. 'Bring your ass next to hers,' I tell my step-mom. Amiee moves into the doggystyle position next to Koda, and they start to kiss while I'm fucking Koda from behind. I move my cock over to Amiee's pussy next. I move back and forth between both of their pussy's, and Amiee tells Koda that she takes my cock so well. A few minutes later, they both flip over into the missionary position and I continue to fuck both of their pussy's back and forth. Both of their tits bounce up and down while I fuck them. I take my cock out of Amiee's pussy and she puts it in her mouth again. She licks and sucks all of her pussy juice off of my cock. I fuck Koda's pussy in the missionary position until I am ready to cum. Then, I jerk my cock off into Koda's mouth and all over her face! 'Step-mom, are you sure you're okay with this?!' I ask. 'Yes!' Amiee exclaims.
Taboo Heat - Cory Chase & Ember Springs - Breeding My Step Sister
File: pvyujnatahecorembl1riglj2qq.mp4
Size: 2.01 GB
Duration: 56:48
Resolution: 1920x1080
Format: mp4
Description: Confession-
My Luke Longly step-sister, Ember Springs, is coming to stay with my wife and I while she is going through a divorce. My wife, Cory Chase, is wearing a green dress as she leads Ember into the guest bedroom. Ember is wearing a red top with a black skirt. 'I have to confess something to you. I let Luke stick his finger in my butt, the last time I was here. I helped him on his journey of self discovery,' Ember tells my wife. 'I have one more thing to confess. I really want to try out the breeding kink,' Ember continues. 'So you want a creampie? You want cum to be inside of your pussy?' Cory asks, 'Yeah! My ex-husband was so boring in bed. He was so vanilla,' Ember says. 'So you want to do some breeding with my husband? I mean, I guess but only if I can watch and maybe participate,' Cory tells her. 'Before we tell Luke that you're here, I think you and I should have some fun alone!' Cory says. Cory leans forward and she starts to kiss Ember. Then Cory lifts Ember's shirt up and she starts to lick and suck on her nipples. Ember unzips Cory's green dress and she pulls it off of her. Cory has no bra or panties underneath! Ember lies down on the bed and Cory starts to eat her pussy out until she cums in her mouth. Then they switch positions and Ember eats Cory's pussy out until she cums this time.
Reflecting-
I am in the bathroom when I hear a knock on the door. 'Hello? Who is it?' I call out. In walks my step-sister, Ember! I had no idea that she had even arrived yet! She walks in wearing see-through green lingerie. 'Don't you like my outfit?!' she asks me. 'I do! Can you close the door so that my wife won't walk in on us? Also, your tits look a bit bigger!' I tell Ember. Ember pulls her top down, exposing her big tits to me. I reach out and I feel her big tits up. She moves her ass into my face and I pull her green g-string off of her. I finger her ass hole just like I did last time, and then I start to rub her clit as well. She gets down on her knees in front of me and she starts to give me a blowjob. Then she stands up and she leans against the bathroom sink in the doggystyle position, and I start to fuck her pussy from behind. She flips over so she is now facing me, and she sits on the edge of the bathroom sink. I fuck her pussy with her big tits in my face. She moves back into the doggystyle position and I continue fucking her pussy from behind.
Butt First-
I follow Ember out of the bathroom, and when we walk into the bedroom, I am greeted with a surprise! My wife, Cory, is sitting down on the bed and she is completely naked. 'Hello there! What have you been doing?' Cory asks me. 'Hanging out with my step-sister!' I reply. 'And were you sticking your fingers in her ass this time?' Cory giggles. 'She also has a new kink! Has she told you yet?' Cory asks. 'I haven't told him yet!' Ember says. 'My newest kink has been breeding! I've been craving a creampie!' Ember confesses. 'So are you going to put your seed deep inside of her pussy?! Do it for me!' Cory tells me. I agree to help my step-sister fulfill her breeding kink. Cory pulls my cock out from under my shorts and she starts to give me a blowjob. They both start to give me a double blowjob, until my cock is fully hard. Cory climbs on top of me and she starts by riding my cock in the reverse cowgirl position with her pussy. It doesn't take long for her to move my cock out of her pussy and into her ass. I have Ember move into the missionary position at the edge of the bed next, and I start by fucking her pussy before I fuck her ass. While she is still lying on her back, I slowly start to fuck her tight ass for the first time. Cory is lying down behind us, rubbing her clit as she watches us. I have the two MILF's move into the doggystyle position next to each other, and I go back and forth between fucking all four of their holes. A few minutes later, while Cory is still in the doggystyle position, Ember switches into the missionary position next to her. Then they both switch positions and Cory lies down in the missionary position while Ember is in the doggystyle position. I fuck both their pussy's and asses in no particular order. When I get close to cumming, I have Ember lie down in the missionary position and I fuck her pussy until I cum deep inside of her. Some of my cum drips out of her but she fingers it back inside.
My Luke Longly step-sister, Ember Springs, is coming to stay with my wife and I while she is going through a divorce. My wife, Cory Chase, is wearing a green dress as she leads Ember into the guest bedroom. Ember is wearing a red top with a black skirt. 'I have to confess something to you. I let Luke stick his finger in my butt, the last time I was here. I helped him on his journey of self discovery,' Ember tells my wife. 'I have one more thing to confess. I really want to try out the breeding kink,' Ember continues. 'So you want a creampie? You want cum to be inside of your pussy?' Cory asks, 'Yeah! My ex-husband was so boring in bed. He was so vanilla,' Ember says. 'So you want to do some breeding with my husband? I mean, I guess but only if I can watch and maybe participate,' Cory tells her. 'Before we tell Luke that you're here, I think you and I should have some fun alone!' Cory says. Cory leans forward and she starts to kiss Ember. Then Cory lifts Ember's shirt up and she starts to lick and suck on her nipples. Ember unzips Cory's green dress and she pulls it off of her. Cory has no bra or panties underneath! Ember lies down on the bed and Cory starts to eat her pussy out until she cums in her mouth. Then they switch positions and Ember eats Cory's pussy out until she cums this time.
Reflecting-
I am in the bathroom when I hear a knock on the door. 'Hello? Who is it?' I call out. In walks my step-sister, Ember! I had no idea that she had even arrived yet! She walks in wearing see-through green lingerie. 'Don't you like my outfit?!' she asks me. 'I do! Can you close the door so that my wife won't walk in on us? Also, your tits look a bit bigger!' I tell Ember. Ember pulls her top down, exposing her big tits to me. I reach out and I feel her big tits up. She moves her ass into my face and I pull her green g-string off of her. I finger her ass hole just like I did last time, and then I start to rub her clit as well. She gets down on her knees in front of me and she starts to give me a blowjob. Then she stands up and she leans against the bathroom sink in the doggystyle position, and I start to fuck her pussy from behind. She flips over so she is now facing me, and she sits on the edge of the bathroom sink. I fuck her pussy with her big tits in my face. She moves back into the doggystyle position and I continue fucking her pussy from behind.
Butt First-
I follow Ember out of the bathroom, and when we walk into the bedroom, I am greeted with a surprise! My wife, Cory, is sitting down on the bed and she is completely naked. 'Hello there! What have you been doing?' Cory asks me. 'Hanging out with my step-sister!' I reply. 'And were you sticking your fingers in her ass this time?' Cory giggles. 'She also has a new kink! Has she told you yet?' Cory asks. 'I haven't told him yet!' Ember says. 'My newest kink has been breeding! I've been craving a creampie!' Ember confesses. 'So are you going to put your seed deep inside of her pussy?! Do it for me!' Cory tells me. I agree to help my step-sister fulfill her breeding kink. Cory pulls my cock out from under my shorts and she starts to give me a blowjob. They both start to give me a double blowjob, until my cock is fully hard. Cory climbs on top of me and she starts by riding my cock in the reverse cowgirl position with her pussy. It doesn't take long for her to move my cock out of her pussy and into her ass. I have Ember move into the missionary position at the edge of the bed next, and I start by fucking her pussy before I fuck her ass. While she is still lying on her back, I slowly start to fuck her tight ass for the first time. Cory is lying down behind us, rubbing her clit as she watches us. I have the two MILF's move into the doggystyle position next to each other, and I go back and forth between fucking all four of their holes. A few minutes later, while Cory is still in the doggystyle position, Ember switches into the missionary position next to her. Then they both switch positions and Cory lies down in the missionary position while Ember is in the doggystyle position. I fuck both their pussy's and asses in no particular order. When I get close to cumming, I have Ember lie down in the missionary position and I fuck her pussy until I cum deep inside of her. Some of my cum drips out of her but she fingers it back inside.
Taboo Heat - Cory Chase - Playoffs Weekend Recovery BTS
File: uxuvdnatahecorchaig6suqg6km.mp4
Size: 1.67 GB
Duration: 39:39
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Ember Springs & Cory Chase - Breeding My Step Sister
File: lqettnataheembcorl8ijkttkek.mp4
Size: 2.01 GB
Duration: 56:48
Resolution: 1920x1080
Format: mp4
Description: Confession-
My Luke Longly step-sister, Ember Springs, is coming to stay with my wife and I while she is going through a divorce. My wife, Cory Chase, is wearing a green dress as she leads Ember into the guest bedroom. Ember is wearing a red top with a black skirt. 'I have to confess something to you. I let Luke stick his finger in my butt, the last time I was here. I helped him on his journey of self discovery,' Ember tells my wife. 'I have one more thing to confess. I really want to try out the breeding kink,' Ember continues. 'So you want a creampie? You want cum to be inside of your pussy?' Cory asks, 'Yeah! My ex-husband was so boring in bed. He was so vanilla,' Ember says. 'So you want to do some breeding with my husband? I mean, I guess but only if I can watch and maybe participate,' Cory tells her. 'Before we tell Luke that you're here, I think you and I should have some fun alone!' Cory says. Cory leans forward and she starts to kiss Ember. Then Cory lifts Ember's shirt up and she starts to lick and suck on her nipples. Ember unzips Cory's green dress and she pulls it off of her. Cory has no bra or panties underneath! Ember lies down on the bed and Cory starts to eat her pussy out until she cums in her mouth. Then they switch positions and Ember eats Cory's pussy out until she cums this time.
Reflecting-
I am in the bathroom when I hear a knock on the door. 'Hello? Who is it?' I call out. In walks my step-sister, Ember! I had no idea that she had even arrived yet! She walks in wearing see-through green lingerie. 'Don't you like my outfit?!' she asks me. 'I do! Can you close the door so that my wife won't walk in on us? Also, your tits look a bit bigger!' I tell Ember. Ember pulls her top down, exposing her big tits to me. I reach out and I feel her big tits up. She moves her ass into my face and I pull her green g-string off of her. I finger her ass hole just like I did last time, and then I start to rub her clit as well. She gets down on her knees in front of me and she starts to give me a blowjob. Then she stands up and she leans against the bathroom sink in the doggystyle position, and I start to fuck her pussy from behind. She flips over so she is now facing me, and she sits on the edge of the bathroom sink. I fuck her pussy with her big tits in my face. She moves back into the doggystyle position and I continue fucking her pussy from behind.
Butt First-
I follow Ember out of the bathroom, and when we walk into the bedroom, I am greeted with a surprise! My wife, Cory, is sitting down on the bed and she is completely naked. 'Hello there! What have you been doing?' Cory asks me. 'Hanging out with my step-sister!' I reply. 'And were you sticking your fingers in her ass this time?' Cory giggles. 'She also has a new kink! Has she told you yet?' Cory asks. 'I haven't told him yet!' Ember says. 'My newest kink has been breeding! I've been craving a creampie!' Ember confesses. 'So are you going to put your seed deep inside of her pussy?! Do it for me!' Cory tells me. I agree to help my step-sister fulfill her breeding kink. Cory pulls my cock out from under my shorts and she starts to give me a blowjob. They both start to give me a double blowjob, until my cock is fully hard. Cory climbs on top of me and she starts by riding my cock in the reverse cowgirl position with her pussy. It doesn't take long for her to move my cock out of her pussy and into her ass. I have Ember move into the missionary position at the edge of the bed next, and I start by fucking her pussy before I fuck her ass. While she is still lying on her back, I slowly start to fuck her tight ass for the first time. Cory is lying down behind us, rubbing her clit as she watches us. I have the two MILF's move into the doggystyle position next to each other, and I go back and forth between fucking all four of their holes. A few minutes later, while Cory is still in the doggystyle position, Ember switches into the missionary position next to her. Then they both switch positions and Cory lies down in the missionary position while Ember is in the doggystyle position. I fuck both their pussy's and asses in no particular order. When I get close to cumming, I have Ember lie down in the missionary position and I fuck her pussy until I cum deep inside of her. Some of my cum drips out of her but she fingers it back inside.
My Luke Longly step-sister, Ember Springs, is coming to stay with my wife and I while she is going through a divorce. My wife, Cory Chase, is wearing a green dress as she leads Ember into the guest bedroom. Ember is wearing a red top with a black skirt. 'I have to confess something to you. I let Luke stick his finger in my butt, the last time I was here. I helped him on his journey of self discovery,' Ember tells my wife. 'I have one more thing to confess. I really want to try out the breeding kink,' Ember continues. 'So you want a creampie? You want cum to be inside of your pussy?' Cory asks, 'Yeah! My ex-husband was so boring in bed. He was so vanilla,' Ember says. 'So you want to do some breeding with my husband? I mean, I guess but only if I can watch and maybe participate,' Cory tells her. 'Before we tell Luke that you're here, I think you and I should have some fun alone!' Cory says. Cory leans forward and she starts to kiss Ember. Then Cory lifts Ember's shirt up and she starts to lick and suck on her nipples. Ember unzips Cory's green dress and she pulls it off of her. Cory has no bra or panties underneath! Ember lies down on the bed and Cory starts to eat her pussy out until she cums in her mouth. Then they switch positions and Ember eats Cory's pussy out until she cums this time.
Reflecting-
I am in the bathroom when I hear a knock on the door. 'Hello? Who is it?' I call out. In walks my step-sister, Ember! I had no idea that she had even arrived yet! She walks in wearing see-through green lingerie. 'Don't you like my outfit?!' she asks me. 'I do! Can you close the door so that my wife won't walk in on us? Also, your tits look a bit bigger!' I tell Ember. Ember pulls her top down, exposing her big tits to me. I reach out and I feel her big tits up. She moves her ass into my face and I pull her green g-string off of her. I finger her ass hole just like I did last time, and then I start to rub her clit as well. She gets down on her knees in front of me and she starts to give me a blowjob. Then she stands up and she leans against the bathroom sink in the doggystyle position, and I start to fuck her pussy from behind. She flips over so she is now facing me, and she sits on the edge of the bathroom sink. I fuck her pussy with her big tits in my face. She moves back into the doggystyle position and I continue fucking her pussy from behind.
Butt First-
I follow Ember out of the bathroom, and when we walk into the bedroom, I am greeted with a surprise! My wife, Cory, is sitting down on the bed and she is completely naked. 'Hello there! What have you been doing?' Cory asks me. 'Hanging out with my step-sister!' I reply. 'And were you sticking your fingers in her ass this time?' Cory giggles. 'She also has a new kink! Has she told you yet?' Cory asks. 'I haven't told him yet!' Ember says. 'My newest kink has been breeding! I've been craving a creampie!' Ember confesses. 'So are you going to put your seed deep inside of her pussy?! Do it for me!' Cory tells me. I agree to help my step-sister fulfill her breeding kink. Cory pulls my cock out from under my shorts and she starts to give me a blowjob. They both start to give me a double blowjob, until my cock is fully hard. Cory climbs on top of me and she starts by riding my cock in the reverse cowgirl position with her pussy. It doesn't take long for her to move my cock out of her pussy and into her ass. I have Ember move into the missionary position at the edge of the bed next, and I start by fucking her pussy before I fuck her ass. While she is still lying on her back, I slowly start to fuck her tight ass for the first time. Cory is lying down behind us, rubbing her clit as she watches us. I have the two MILF's move into the doggystyle position next to each other, and I go back and forth between fucking all four of their holes. A few minutes later, while Cory is still in the doggystyle position, Ember switches into the missionary position next to her. Then they both switch positions and Cory lies down in the missionary position while Ember is in the doggystyle position. I fuck both their pussy's and asses in no particular order. When I get close to cumming, I have Ember lie down in the missionary position and I fuck her pussy until I cum deep inside of her. Some of my cum drips out of her but she fingers it back inside.
Taboo Heat - Cadence Lux & Cory Chase - Step Daughter Returns
File: kfa9hnatahecadcor7sxq4n3eyi.mp4
Size: 1.39 GB
Duration: 57:56
Resolution: 1920x1080
Format: mp4
Description: Cadence Lux- StepDaughter Returns. StepDad Reunion-
I am working inside of my garage when I hear a car pull up to my driveway. 'Step-daddy!' a voice calls out. I walk over to see who it is. 'Cadence!? Is that you?! You've been gone for 7 years,' I gasp. 'I know. I owe you an explanation. I have this top secret government job and I had to wait until I wouldn't be in any danger before I came back to see you,' she explains. 'Whoa!' I exclaim. 'I've missed you so much though! I miss when you used to sneak into my bedroom with that hard cock,' she says to me. She pulls her top down, exposing her tits to me.
I am working inside of my garage when I hear a car pull up to my driveway. 'Step-daddy!' a voice calls out. I walk over to see who it is. 'Cadence!? Is that you?! You've been gone for 7 years,' I gasp. 'I know. I owe you an explanation. I have this top secret government job and I had to wait until I wouldn't be in any danger before I came back to see you,' she explains. 'Whoa!' I exclaim. 'I've missed you so much though! I miss when you used to sneak into my bedroom with that hard cock,' she says to me. She pulls her top down, exposing her tits to me.
Taboo Heat - Cory Chase & Mandi Love - Step Sister Obsession
File: ywyj4natahecormanvbwbvigqvl.mp4
Size: 528.94 MB
Duration: 18:08
Resolution: 1920x1080
Format: mp4
Description: Step Threesome-
'I can't believe I forgot my water bottle!' I whisper to myself. I enter the gym and I hear loud moaning sounds coming from the other side of the gym. 'What is going on here?!' I gasp when I find my step-sister eating out my wife's pussy! 'She is eating my pussy out, as you can see,' Cory says. Yes, I can definitely see that! 'I know that you came inside of her,' Cory says next. 'Yes, I did! Can I join you guys here as well?' I ask. Cory invites me to join them by putting my cock in her mouth, while Mandi is still going down on Cory. I walk behind Mandi next and I start to fuck Mandi's pussy from behind while she is eating out Cory. I have the two of them sit down next to each other in the missionary position, and I start to fuck Cory's pussy first. Then I move over to fucking Mandi's pussy next. I go back and forth between the two of them, and their big tits bounce up and down as I fuck them. They both flip over into the doggystyle position next and I go back and forth between fucking them from behind. They move back into the missionary position and I fuck Mandi's pussy until I am ready to cum. I creampie my step-sister's pussy for the second time! My wife sucks some of my cum out of Mandi's pussy though! 'I think we are going to have a fun summer together!' I tell them.
'I can't believe I forgot my water bottle!' I whisper to myself. I enter the gym and I hear loud moaning sounds coming from the other side of the gym. 'What is going on here?!' I gasp when I find my step-sister eating out my wife's pussy! 'She is eating my pussy out, as you can see,' Cory says. Yes, I can definitely see that! 'I know that you came inside of her,' Cory says next. 'Yes, I did! Can I join you guys here as well?' I ask. Cory invites me to join them by putting my cock in her mouth, while Mandi is still going down on Cory. I walk behind Mandi next and I start to fuck Mandi's pussy from behind while she is eating out Cory. I have the two of them sit down next to each other in the missionary position, and I start to fuck Cory's pussy first. Then I move over to fucking Mandi's pussy next. I go back and forth between the two of them, and their big tits bounce up and down as I fuck them. They both flip over into the doggystyle position next and I go back and forth between fucking them from behind. They move back into the missionary position and I fuck Mandi's pussy until I am ready to cum. I creampie my step-sister's pussy for the second time! My wife sucks some of my cum out of Mandi's pussy though! 'I think we are going to have a fun summer together!' I tell them.
Taboo Heat - Ember Springs - Ember Springs In BBC Bully
File: aureonataheembsprytsjvfofyg.mp4
Size: 1.99 GB
Duration: 25:14
Resolution: 3840x2160
Format: mp4
Description: Detective Don Sudan is sitting down at his desk, when Ember Springs walks in. 'Who are you, and where is Luke?!' the detective questions her. 'He's not here right now, Officer,' she responds. 'Can you go find him for me?! He owes me some favors,' the detective says. 'Let me call him real quick,' she says. She steps away and she calls Luke on the phone. 'There is a detective here looking for you and he says that you owe him a favor,' she whispers into the phone. 'Do you want Cory?' she says to the detective.
'No, I want something different this time!' the detective shouts. Ember continues to talk to Luke on the phone. 'You want to offer ME to him?!' she says into the phone. She hangs up the phone and she walks over to the gym. She strips out of her pants and her bra. Once she is completely naked, she lies down on a weight bench in the missionary position. 'Detective! I have that favor ready for you!' she shouts. Detective Sudan walks over to where she is lying down. 'Luke owes me a lot of favors, just so you know. But this could work,' he says to her. He pulls out his BBC and she starts to give him a blowjob. Once his cock is nice and hard, he starts to fuck her pussy in the missionary position. 'It feels so big, Detective! I'm going to cum already!' she moans. She cums on his cock, and he continues to fuck her pussy. She climbs on top of him and she starts to ride his BBC in the cowgirl position next. A few minutes later, she lies down in the missionary position again and he fucks her pussy harder now. She moves into the doggystyle position, and her tits bounce back and forth as he fucks her. She goes back into the missionary position and he fucks her pussy until he is ready to cum. Then, he pulls his cock out of her pussy and he jerks his cock off into her mouth. She swallows it all! 'You taste good, Detective,' she tells him. 'Tell Luke that I'll see him in a week,' he responds.
'No, I want something different this time!' the detective shouts. Ember continues to talk to Luke on the phone. 'You want to offer ME to him?!' she says into the phone. She hangs up the phone and she walks over to the gym. She strips out of her pants and her bra. Once she is completely naked, she lies down on a weight bench in the missionary position. 'Detective! I have that favor ready for you!' she shouts. Detective Sudan walks over to where she is lying down. 'Luke owes me a lot of favors, just so you know. But this could work,' he says to her. He pulls out his BBC and she starts to give him a blowjob. Once his cock is nice and hard, he starts to fuck her pussy in the missionary position. 'It feels so big, Detective! I'm going to cum already!' she moans. She cums on his cock, and he continues to fuck her pussy. She climbs on top of him and she starts to ride his BBC in the cowgirl position next. A few minutes later, she lies down in the missionary position again and he fucks her pussy harder now. She moves into the doggystyle position, and her tits bounce back and forth as he fucks her. She goes back into the missionary position and he fucks her pussy until he is ready to cum. Then, he pulls his cock out of her pussy and he jerks his cock off into her mouth. She swallows it all! 'You taste good, Detective,' she tells him. 'Tell Luke that I'll see him in a week,' he responds.
Taboo Heat - Cory Chase & Juniper Ren - V2 Huge Cocks
File: hclrynatahecorjunsv7f22psej.mp4
Size: 774.23 MB
Duration: 32:00
Resolution: 1920x1080
Format: mp4
Description: Juniper Ren is wearing an orange bikini as her step-mom, Cory Chase, walks into her bedroom. 'I wanted to talk to you about your anal training and see how it was going,' Cory says to her. Cory is wearing a purple bikini as she sits down next to Juniper on the bed. 'Anal is so out! Do you know what people are now into instead?! They have been fucking these HUGE cocks! Huge cocks are what's popular now! I really want to fuck a huge cock,' Juniper tells Cory. 'Do you know anyone who has a huge cock?'
Juniper continues. 'Well, I do know of a guy who has a BBC,' Cory slowly tells her. 'Can you invite him over?!' Juniper begs her. Cory grabs her phone and she makes a phone call. 'Hey! I'm calling you from my step-daughter's phone number. Would you be able to stop by my house? I have something big to ask you,' Cory says before she hangs up the phone. 'He is on his way over!' Cory tells Juniper. Juniper is super excited She waits by the window for his red car to arrive. 'He's here! He's here!' she gasps. They hear a knock at the door, and Kaby walks into their home. Cory introduces Juniper to Kaby. 'Did you know that anal was so last week, and big cocks are in this week?!'Cory tells Kaby. 'I did not know that,' Kaby laughs. 'My step-daughter wants to try a huge cock, and we wanted to know if you wanted to join us today,' Cory tells him. 'Right now? The three of us? Yeah, I would be down for that!' Kaby replies. Juniper unzips Kaby's pants, and his huge BBC pops out. 'This is massive! That's exactly what I wanted!' Juniper giggles as she puts Kaby's BBC in her mouth. Cory starts to join in and she sucks on Kaby's huge cock as well. Cory pulls her big tits out from under her bikini top, and she titty fucks Kaby's BBC. Cory bends over into the doggystyle position and Kaby starts to fuck her ass from behind. A few minutes later, Cory lies down on the bed in the missionary position, and Kaby continues to fuck her holes. At the same time, Juniper sits on Cory's face and Cory eats her step-daughter's pussy out. Kaby fucks Cory's ass and pussy back and forth. Juniper climbs on top of Kaby next and she rides his cock in the reverse cowgirl position with her pussy. She slowly bounces up and down on his huge cock. Cory licks his cock clean, and then Juniper goes back to riding Kaby's BBC. Cory climbs on top of his cock next and she rides him in the reverse cowgirl position. Juniper licks and sucks on Cory's tits while she is riding Kaby's BBC. A few minutes later, Cory climbs off of Kaby's cock and the two women suck his cock again. After they lick his cock clean, Juniper climbs on top of Kaby again and she rides his cock in the cowgirl position some more. Cory licks Juniper's nipples while she is riding Kaby's huge cock. Cory and Juniper both move into the doggystyle position and Kaby goes back and forth between fucking both of their pussy's. Kaby continues to fuck Juniper's pussy from behind, until he is ready to cum. Then he has the two of them move their heads next to each other on the bed, and he jerks his cock off into Juniper's mouth and all over her and Cory's faces!
Juniper continues. 'Well, I do know of a guy who has a BBC,' Cory slowly tells her. 'Can you invite him over?!' Juniper begs her. Cory grabs her phone and she makes a phone call. 'Hey! I'm calling you from my step-daughter's phone number. Would you be able to stop by my house? I have something big to ask you,' Cory says before she hangs up the phone. 'He is on his way over!' Cory tells Juniper. Juniper is super excited She waits by the window for his red car to arrive. 'He's here! He's here!' she gasps. They hear a knock at the door, and Kaby walks into their home. Cory introduces Juniper to Kaby. 'Did you know that anal was so last week, and big cocks are in this week?!'Cory tells Kaby. 'I did not know that,' Kaby laughs. 'My step-daughter wants to try a huge cock, and we wanted to know if you wanted to join us today,' Cory tells him. 'Right now? The three of us? Yeah, I would be down for that!' Kaby replies. Juniper unzips Kaby's pants, and his huge BBC pops out. 'This is massive! That's exactly what I wanted!' Juniper giggles as she puts Kaby's BBC in her mouth. Cory starts to join in and she sucks on Kaby's huge cock as well. Cory pulls her big tits out from under her bikini top, and she titty fucks Kaby's BBC. Cory bends over into the doggystyle position and Kaby starts to fuck her ass from behind. A few minutes later, Cory lies down on the bed in the missionary position, and Kaby continues to fuck her holes. At the same time, Juniper sits on Cory's face and Cory eats her step-daughter's pussy out. Kaby fucks Cory's ass and pussy back and forth. Juniper climbs on top of Kaby next and she rides his cock in the reverse cowgirl position with her pussy. She slowly bounces up and down on his huge cock. Cory licks his cock clean, and then Juniper goes back to riding Kaby's BBC. Cory climbs on top of his cock next and she rides him in the reverse cowgirl position. Juniper licks and sucks on Cory's tits while she is riding Kaby's BBC. A few minutes later, Cory climbs off of Kaby's cock and the two women suck his cock again. After they lick his cock clean, Juniper climbs on top of Kaby again and she rides his cock in the cowgirl position some more. Cory licks Juniper's nipples while she is riding Kaby's huge cock. Cory and Juniper both move into the doggystyle position and Kaby goes back and forth between fucking both of their pussy's. Kaby continues to fuck Juniper's pussy from behind, until he is ready to cum. Then he has the two of them move their heads next to each other on the bed, and he jerks his cock off into Juniper's mouth and all over her and Cory's faces!
Taboo Heat - Cory Chase & Juniper Ren - V1 Intro To Anal 2
File: ydpafnatahecorjun7ftpo6xyo8.mp4
Size: 775.39 MB
Duration: 32:00
Resolution: 1920x1080
Format: mp4
Description: I walk into the living room and I find my wife licking my step-daughter's pussy, and playing with her ass hole! 'Hey! What are you two doing?!' I ask them. 'I was showing her how to do anal!' she tells me. 'Would you be willing to help her out too?' Cory asks me. 'Of course I would love to help!' I tell them. Cory helps Juniper strip out of her dress, and then Cory strips out of her clothes as well. Juniper moves into the doggystyle position and she starts to eat Cory's pussy out while I'm fucking Juniper from behind.
Advanced Practice-
I start with her pussy and then I make my way deep into her ass hole. 'Step-mom's pussy tastes so good!' Juniper moans. Juniper flips over into the missionary position and I continue to fuck her ass hole. Cory moves into the doggystyle position and Juniper spits on her ass hole to lube it up. Then I fuck Cory's ass hole from behind. Juniper also moves into the doggystyle position next to Cory, and I go back and forth between fucking both of their holes. 'Your cock is so deep!' Juniper moans. Cory pulls my cock out of Juniper's ass hole and she licks it clean, before putting my cock back inside of Juniper's ass. Cory climbs on top of me next and she rides my cock in the cowgirl position. Juniper rides my cock with her pussy and her ass in the cowgirl position next. When I am ready to cum, I have them both get down on their knees in front of me and open their mouths wide. Then I jerk my cock off into their mouths and all over their faces!
Advanced Practice-
I start with her pussy and then I make my way deep into her ass hole. 'Step-mom's pussy tastes so good!' Juniper moans. Juniper flips over into the missionary position and I continue to fuck her ass hole. Cory moves into the doggystyle position and Juniper spits on her ass hole to lube it up. Then I fuck Cory's ass hole from behind. Juniper also moves into the doggystyle position next to Cory, and I go back and forth between fucking both of their holes. 'Your cock is so deep!' Juniper moans. Cory pulls my cock out of Juniper's ass hole and she licks it clean, before putting my cock back inside of Juniper's ass. Cory climbs on top of me next and she rides my cock in the cowgirl position. Juniper rides my cock with her pussy and her ass in the cowgirl position next. When I am ready to cum, I have them both get down on their knees in front of me and open their mouths wide. Then I jerk my cock off into their mouths and all over their faces!
Taboo Heat - Juniper Ren & Cory Chase - V1 Intro To Anal
File: vkeojnatahejuncor1xmsxivcvi.mp4
Size: 315.98 MB
Duration: 18:19
Resolution: 1920x1080
Format: mp4
Description: Pleasure- My wife, Cory, is sitting down on the couch and she is watching a TV show. She is wearing a light pink top with a dark pink skirt, when our step-daughter walks into the living room and sits down next to her. Juniper is wearing a light yellow sun dress. 'Step-mom, I have a question for you. Everyone at college is always talking about anal sex and I don't know anything about that yet! What is the big deal about anal sex?! I don't understand!' Juniper exclaims. 'Well, where do I start?!' Cory giggles.
'Anal sex is amazing and it does give you intense orgasms! I do have a lot of experience with anal sex. I could show you, if you want,' she continues. 'I would love that! Please show me!' Juniper responds. Cory leaves the room and then she comes back with a small bag in her left hand and a bottle of lube in her right hand. She unzips the small bag and she pulls out two different anal buttplugs. Then she pulls out two more, slightly larger, butt plugs next. 'I will show you how these work and then we can go from there,' Cory says. Cory spreads her legs open wide and she has no panties on underneath. She instructs Juniper to also spread her legs open wide, and to start rubbing her clit. She hands Juniper one of the butt plugs while Cory has another butt plug in her own hands. 'Lick the plug, so it will be easier to stick it inside,' Cory says. They both lick the butt plugs and then they start to shove them up their asses. Juniper applies a bit of lube as well, since her virgin ass is tighter than Cory's. While Juniper has the butt plug up her ass, Cory starts to rub Juniper's clit for her. 'It feels so good!' Juniper moans. Cory slowly moves the butt plug in and out of Juniper's ass, to warm her up. Then Cory goes back to moving her own butt plug in and out of her ass while she rubs her clit. Cory then starts to lick Juniper's pussy while she continues to move the butt plug in and out of her ass.
'Anal sex is amazing and it does give you intense orgasms! I do have a lot of experience with anal sex. I could show you, if you want,' she continues. 'I would love that! Please show me!' Juniper responds. Cory leaves the room and then she comes back with a small bag in her left hand and a bottle of lube in her right hand. She unzips the small bag and she pulls out two different anal buttplugs. Then she pulls out two more, slightly larger, butt plugs next. 'I will show you how these work and then we can go from there,' Cory says. Cory spreads her legs open wide and she has no panties on underneath. She instructs Juniper to also spread her legs open wide, and to start rubbing her clit. She hands Juniper one of the butt plugs while Cory has another butt plug in her own hands. 'Lick the plug, so it will be easier to stick it inside,' Cory says. They both lick the butt plugs and then they start to shove them up their asses. Juniper applies a bit of lube as well, since her virgin ass is tighter than Cory's. While Juniper has the butt plug up her ass, Cory starts to rub Juniper's clit for her. 'It feels so good!' Juniper moans. Cory slowly moves the butt plug in and out of Juniper's ass, to warm her up. Then Cory goes back to moving her own butt plug in and out of her ass while she rubs her clit. Cory then starts to lick Juniper's pussy while she continues to move the butt plug in and out of her ass.
Taboo Heat - Cory Chase & Mandi Love - Step Sister Obsession P2-3
File: cfossnatahecormang7ymgjgy91.mp4
Size: 909.08 MB
Duration: 36:35
Resolution: 1920x1080
Format: mp4
Description: Gym Warm Up-
'I can't believe he left me without finishing! I'm going to go find him at the gym!' Mandi says to herself. She puts on her sneakers because she wants to finish what we started. She is completely naked besides her sneakers as she starts walking over to the gym. 'I want him to finish inside of me!' she says to herself. She walks into the gym and she doesn't see anyone there. At the same time, I am inside the gym's bathroom. I am upset because I was 5 minutes late and my personal trainer left! I guess I will have to work out alone today! I walk out of the bathroom and into the gym and I am shocked to see my step-sister. 'Hey Mandi! You won't believe this but I was 5 minutes later and my personal trainer left. He didn't wait for me!' I tell her. 'Did you really come to the gym completely naked?!' I gasp. 'Yeah, but I have my shoes on!' she giggles. Mandi sits down on the weight bench in front of me.
'I want you to finish inside of me!' she insists. She lies down on the weightbench in the missionary position and she starts to give me a blowjob again. Then I start to fuck her pussy again in the missionary position. A few minutes later, she flips over into the doggystyle position and I fuck her pussy from behind. She moves back into the missionary position and I continue to fuck my step-sister's tight pussy. I move my cock over to her mouth and she sucks my cock while I feel up her big tits. 'Are you sure you want me to creampie you?' I ask her. 'I'm sure! I've wanted this for a while!' she admits. I go back to fucking her pussy in the missionary position, and I start to fuck her harder and harder until I am ready to cum. Then I allow my cock to explode inside of her, and a lot of my cum drips out of her pussy! 'Don't mention this to Cory!' I remind her.
Cory Seduced-
'Where is my husband?' Cory asks Mandi. They are both in the gym, and Cory is wearing dark red work out clothes while Mandi is wearing grey gym shorts with a matching sports bra. 'Luke just left,' Mandi tells my wife. 'Who are you? Why are you here?' Cory asks Mandi. 'I'm Luke's step-sister,' Mandi says. 'Oh my God! It is so nice to meet you! What are you doing here?!' Cory wonders. 'I am staying here for the summer!' Mandi tells her. 'Well, if Luke left, then why are you still here?!' Cory questions her. 'I wanted to stretch myself out!' Mandi says. 'I have a question. Can I show you my new boobs? I want your opinion on them, because your implants look great,' Mandi says to Cory. Mandi pulls her big, enhanced tits out from under her top and she shows Cory. 'Now can you show me your boobs?' Mandi asks. Cory pulls her big, enhanced tits out from under her bra next. Mandi asks my wife if she can taste her nipples, and Cory says yes. Mandi starts to lick and suck on Cory's nipples. 'It is kind of strange that I am doing this with you,' Cory says. 'No one has to know!' Mandi responds. Cory wants to return the favor, so she starts to lick Mandi's nipples next. 'You have some amazing cleavage!' Cory gasps. 'Would it be too much to ask to taste your pussy?' Cory asks. 'Only if you want to!' Mandi says. Mandi lies down on the weight bench and she pulls her shorts off to the side. Cory starts to eat her pussy out, and then she pulls her shorts off completely. She keeps eating her pussy out until she cums hard in her mouth! Mandi decides to confess something to Cory. 'I fucked Luke earlier and he creampied me,' Mandi confesses. 'What?! You fucked my husband and he creampied you!? What the fuck!' Cory yells. 'I am mad that you guys didn't include me,' Cory says. Cory lifts Mandi's legs up in the air and she shoves her face into her pussy. Cory continues to eat my step-sister's pussy out! Mandi wants to return the favor, so she helps Cory strip out of her pants and then she starts to eat my wife's pussy out this time.
'I can't believe he left me without finishing! I'm going to go find him at the gym!' Mandi says to herself. She puts on her sneakers because she wants to finish what we started. She is completely naked besides her sneakers as she starts walking over to the gym. 'I want him to finish inside of me!' she says to herself. She walks into the gym and she doesn't see anyone there. At the same time, I am inside the gym's bathroom. I am upset because I was 5 minutes late and my personal trainer left! I guess I will have to work out alone today! I walk out of the bathroom and into the gym and I am shocked to see my step-sister. 'Hey Mandi! You won't believe this but I was 5 minutes later and my personal trainer left. He didn't wait for me!' I tell her. 'Did you really come to the gym completely naked?!' I gasp. 'Yeah, but I have my shoes on!' she giggles. Mandi sits down on the weight bench in front of me.
'I want you to finish inside of me!' she insists. She lies down on the weightbench in the missionary position and she starts to give me a blowjob again. Then I start to fuck her pussy again in the missionary position. A few minutes later, she flips over into the doggystyle position and I fuck her pussy from behind. She moves back into the missionary position and I continue to fuck my step-sister's tight pussy. I move my cock over to her mouth and she sucks my cock while I feel up her big tits. 'Are you sure you want me to creampie you?' I ask her. 'I'm sure! I've wanted this for a while!' she admits. I go back to fucking her pussy in the missionary position, and I start to fuck her harder and harder until I am ready to cum. Then I allow my cock to explode inside of her, and a lot of my cum drips out of her pussy! 'Don't mention this to Cory!' I remind her.
Cory Seduced-
'Where is my husband?' Cory asks Mandi. They are both in the gym, and Cory is wearing dark red work out clothes while Mandi is wearing grey gym shorts with a matching sports bra. 'Luke just left,' Mandi tells my wife. 'Who are you? Why are you here?' Cory asks Mandi. 'I'm Luke's step-sister,' Mandi says. 'Oh my God! It is so nice to meet you! What are you doing here?!' Cory wonders. 'I am staying here for the summer!' Mandi tells her. 'Well, if Luke left, then why are you still here?!' Cory questions her. 'I wanted to stretch myself out!' Mandi says. 'I have a question. Can I show you my new boobs? I want your opinion on them, because your implants look great,' Mandi says to Cory. Mandi pulls her big, enhanced tits out from under her top and she shows Cory. 'Now can you show me your boobs?' Mandi asks. Cory pulls her big, enhanced tits out from under her bra next. Mandi asks my wife if she can taste her nipples, and Cory says yes. Mandi starts to lick and suck on Cory's nipples. 'It is kind of strange that I am doing this with you,' Cory says. 'No one has to know!' Mandi responds. Cory wants to return the favor, so she starts to lick Mandi's nipples next. 'You have some amazing cleavage!' Cory gasps. 'Would it be too much to ask to taste your pussy?' Cory asks. 'Only if you want to!' Mandi says. Mandi lies down on the weight bench and she pulls her shorts off to the side. Cory starts to eat her pussy out, and then she pulls her shorts off completely. She keeps eating her pussy out until she cums hard in her mouth! Mandi decides to confess something to Cory. 'I fucked Luke earlier and he creampied me,' Mandi confesses. 'What?! You fucked my husband and he creampied you!? What the fuck!' Cory yells. 'I am mad that you guys didn't include me,' Cory says. Cory lifts Mandi's legs up in the air and she shoves her face into her pussy. Cory continues to eat my step-sister's pussy out! Mandi wants to return the favor, so she helps Cory strip out of her pants and then she starts to eat my wife's pussy out this time.
Taboo Heat - Mandi Lane - Step Sister Obsession P1
File: lvhe1natahemanlan3mmkjrn638.mp4
Size: 454.36 MB
Duration: 18:51
Resolution: 1920x1080
Format: mp4
Description: 'Hey Mandi! How was your trip! I'm so glad to see you!' I say to my step-sister as she walks into my house. 'It was good!' she says, as she follows me down to her room at the end of the hall. She is wearing a pink dress with a matching pink suitcase in her hands. 'I have a surprise for you. Close your eyes!' she says to me. I close my eyes, and when I open them she is topless! She has huge boobs now! 'Where did you get those from?!' I gasp. 'I bought them!' she giggles. She invites me to touch them and I hesitate at first just because she is my step-sister afterall. But her boobs are so huge that I easily give in. I tell her that I need to go to the gym, and she insists on showing me what gym clothes she packed and brought with her...
She puts on a black top with beige shorts, and then she decides to show me the second gym outfit she brought. She puts on a grey top with matching grey shorts next. 'I have about 10 minutes before I'm going to leave for the gym. Maybe we could have some fun quickly,' I tell her. She pulls her big tits out from under the grey top. She pulls her shorts and panties off and then she joins me on the bed. She pulls my cock out and she starts to jerk my cock off with her hand. A few moments later, she adds her mouth to my cock and she starts to give me a blowjob. While she is sucking my cock, I decide to ask her why she chose to get huge breast implants. 'I was tired of my A cup's so I decided to get triple D's! I'm glad you like them! Do you want to put your cock in between my tits?' she asks me. 'Oh yeah!' I respond. She puts my hard cock in between her giant tits, and then she starts to suck my cock again. She lies down on the bed in the missionary position and I start to fuck my step-sister's pussy. Her big tits bounce up and down with every thrust. She climbs on top of me and she rides my cock in the cowgirl position next. All of a sudden I realize that 10 minutes have gone by and I need to meet my trainer at the gym! 'We will finish this later!' I tell her, before I run off!
She puts on a black top with beige shorts, and then she decides to show me the second gym outfit she brought. She puts on a grey top with matching grey shorts next. 'I have about 10 minutes before I'm going to leave for the gym. Maybe we could have some fun quickly,' I tell her. She pulls her big tits out from under the grey top. She pulls her shorts and panties off and then she joins me on the bed. She pulls my cock out and she starts to jerk my cock off with her hand. A few moments later, she adds her mouth to my cock and she starts to give me a blowjob. While she is sucking my cock, I decide to ask her why she chose to get huge breast implants. 'I was tired of my A cup's so I decided to get triple D's! I'm glad you like them! Do you want to put your cock in between my tits?' she asks me. 'Oh yeah!' I respond. She puts my hard cock in between her giant tits, and then she starts to suck my cock again. She lies down on the bed in the missionary position and I start to fuck my step-sister's pussy. Her big tits bounce up and down with every thrust. She climbs on top of me and she rides my cock in the cowgirl position next. All of a sudden I realize that 10 minutes have gone by and I need to meet my trainer at the gym! 'We will finish this later!' I tell her, before I run off!
Taboo Heat - Melanie Hicks - Ivys Day Off Porn Parody
File: jhuzanatahemelhicmwnh4vqgtk.mp4
Size: 1.20 GB
Duration: 34:10
Resolution: 1920x1080
Format: mp4
Description: 'Today was a long day of mayhem,' Ivy Melanie Hicks says to herself. She is wearing a green dress that she is eager to take off. She replaces the dress with a green bra and panty set, and then she makes her way over to her bed. She lies down on her bed and she spreads her legs and starts to play with her pussy to relax. 'This isn't really doing the job. Let me call Detective Don Sudan and see if he can come over,' she says to herself as she grabs her phone. 'Hey! It's me!
I'm in some trouble and I could really use your help. The bat is here! Please come over,' she says to him. He agrees that he will come on over! A few minutes later, Detective Sudan arrives. 'I got here as soon as I could! Where is the bat?!' he exclaims. 'There's actually no bat, but I had a really long day causing mayhem, so I kinda needed a stress release,' she explains to him. 'I love the outfit but I've got to go. I have too many cases that I'm working on right now,' he says to her. He begins to walk away, but Ivy has other plans for him. Ivy releases her pheromones to put Detective Sudan in a better mood. Suddenly, his mood has shifted and he is prepared to stay and please Ivy! She starts to rub his cock over his pants. She pulls his BBC out from under his pants and she starts to give him a blowjob. His cock is so huge that she has to use her hands and her mouth at the same time. She pulls her big, natural tits out from under her bra and then she goes back to sucking his cock. Once his cock is nice and hard, Ivy climbs on top of him and she starts to ride his cock in the reverse cowgirl position. A few minutes later, she moves into the regular cowgirl position instead. Then she lies down on the bed in the missionary position and he continues to fuck her pussy. She turns on her side and he fucks her pussy a little harder now. 'Put that ass in the air for me,' Detective Sudan tells Ivy. She moves into the doggystyle position and he fucks her pussy from behind. Her big tits sway back and forth while he fucks her. She lies down on her back and he fucks her pussy in the missionary position again. 'Detective, I am ready for your seed,' she moans. He fucks her pussy for another minute until he is ready to cum. Then, he jerks his cock off into her mouth and all over her face! After he cums, Ivy's pheromones suddenly wear off. 'What just happened?! Oh my God! Why do you always do this to me?! I had things to do!' the detective cries before he runs off.
I'm in some trouble and I could really use your help. The bat is here! Please come over,' she says to him. He agrees that he will come on over! A few minutes later, Detective Sudan arrives. 'I got here as soon as I could! Where is the bat?!' he exclaims. 'There's actually no bat, but I had a really long day causing mayhem, so I kinda needed a stress release,' she explains to him. 'I love the outfit but I've got to go. I have too many cases that I'm working on right now,' he says to her. He begins to walk away, but Ivy has other plans for him. Ivy releases her pheromones to put Detective Sudan in a better mood. Suddenly, his mood has shifted and he is prepared to stay and please Ivy! She starts to rub his cock over his pants. She pulls his BBC out from under his pants and she starts to give him a blowjob. His cock is so huge that she has to use her hands and her mouth at the same time. She pulls her big, natural tits out from under her bra and then she goes back to sucking his cock. Once his cock is nice and hard, Ivy climbs on top of him and she starts to ride his cock in the reverse cowgirl position. A few minutes later, she moves into the regular cowgirl position instead. Then she lies down on the bed in the missionary position and he continues to fuck her pussy. She turns on her side and he fucks her pussy a little harder now. 'Put that ass in the air for me,' Detective Sudan tells Ivy. She moves into the doggystyle position and he fucks her pussy from behind. Her big tits sway back and forth while he fucks her. She lies down on her back and he fucks her pussy in the missionary position again. 'Detective, I am ready for your seed,' she moans. He fucks her pussy for another minute until he is ready to cum. Then, he jerks his cock off into her mouth and all over her face! After he cums, Ivy's pheromones suddenly wear off. 'What just happened?! Oh my God! Why do you always do this to me?! I had things to do!' the detective cries before he runs off.
Taboo Heat - Rae West - The Cops Perps Personal Fuck Toy
File: 24brbnataheraewesbwtvzawjgt.mp4
Size: 612.55 MB
Duration: 32:23
Resolution: 1920x1080
Format: mp4
Description: I walk over to the gym and I start to lift some weights. I hear footsteps behind me, and when I turn around, Rae the Cop is standing behind me! She grabs me by the collar and she tells me that she is a cop now. 'Did you enjoy what we did before? Do you want to do it again? I ask her. 'I mean, yeah,' she says. I grab her handcuffs and I handcuff her own hands behind her back first. I unzip her police vest next, and her big, natural tits are now exposed. I stand behind her and I start to feel her tits.
I pull my cock out from under my shorts next, and she starts to give me a blowjob. 'Oh, officer!' I moan. 'These handcuffs are a little tight,' she tells me. I uncuff her so her hands are now free. She lies down on the weight bench in the missionary position, and I pull her pants off. 'No underwear?! Wow!' I gasp. I lick her clit for a few minutes to get her wet, and then I put my cock in her mouth again. Then I fuck her pussy in the missionary position next. 'Fuck me hard, punk!' she moans. I wrap my hand around her throat while I fuck her pussy. I handcuff her hands behind her head, and then I go back to fucking her pussy. I grab her tits while I fuck her. I put my cock in her mouth again and she gives me a blowjob. I flip her over into the doggystyle position next and I continue to fuck her pussy from behind. Her big tits bounce back and forth while I am thrusting my cock deep inside of her. Her moans get louder and louder with every thrust. I flip her over into the missionary position and I continue to fuck her pussy while her hands are still handcuffed together. I grab her and I move her up against the wall. I pull her hair from behind while I am fucking her while standing up. I make her give me a blowjob next, and she gags on my cock. I lean her up against the weight bench next, in the doggystyle position, and I pound her pussy from behind. I finally allow her hands to be uncuffed, and then I move her onto the weight bench in the missionary position. I wrap my hand around her throat while I am fucking her. 'Does your captain know you're here?' I ask her. 'No, I lied and said that I was going out to lunch,' she responds. 'We better hurry up then! Don't want your captain asking questions!' I exclaim. I fuck her pussy harder now, while telling her that she is a dirty little slut. 'Yes I am a dirty slut!' she repeats back to me. When I am finally ready to cum, I pull my cock out of her pussy and I jerk my cock off into her mouth and on her face! Then I grab the handcuffs again and I cuff her hands back up. 'You can't go anywhere now!' I exclaim. I then grab a rope and I tie her feet down to the weight bench as well. I decide to uncuff the handcuffs and I throw her police vest at her.
I pull my cock out from under my shorts next, and she starts to give me a blowjob. 'Oh, officer!' I moan. 'These handcuffs are a little tight,' she tells me. I uncuff her so her hands are now free. She lies down on the weight bench in the missionary position, and I pull her pants off. 'No underwear?! Wow!' I gasp. I lick her clit for a few minutes to get her wet, and then I put my cock in her mouth again. Then I fuck her pussy in the missionary position next. 'Fuck me hard, punk!' she moans. I wrap my hand around her throat while I fuck her pussy. I handcuff her hands behind her head, and then I go back to fucking her pussy. I grab her tits while I fuck her. I put my cock in her mouth again and she gives me a blowjob. I flip her over into the doggystyle position next and I continue to fuck her pussy from behind. Her big tits bounce back and forth while I am thrusting my cock deep inside of her. Her moans get louder and louder with every thrust. I flip her over into the missionary position and I continue to fuck her pussy while her hands are still handcuffed together. I grab her and I move her up against the wall. I pull her hair from behind while I am fucking her while standing up. I make her give me a blowjob next, and she gags on my cock. I lean her up against the weight bench next, in the doggystyle position, and I pound her pussy from behind. I finally allow her hands to be uncuffed, and then I move her onto the weight bench in the missionary position. I wrap my hand around her throat while I am fucking her. 'Does your captain know you're here?' I ask her. 'No, I lied and said that I was going out to lunch,' she responds. 'We better hurry up then! Don't want your captain asking questions!' I exclaim. I fuck her pussy harder now, while telling her that she is a dirty little slut. 'Yes I am a dirty slut!' she repeats back to me. When I am finally ready to cum, I pull my cock out of her pussy and I jerk my cock off into her mouth and on her face! Then I grab the handcuffs again and I cuff her hands back up. 'You can't go anywhere now!' I exclaim. I then grab a rope and I tie her feet down to the weight bench as well. I decide to uncuff the handcuffs and I throw her police vest at her.
Taboo Heat - Violet Voss - BTS BBC Championship S2 Playoffs
File: 24n5vnataheviovosrreg6mosor.mp4
Size: 1.43 GB
Duration: 39:30
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Cory Chase - Spring Break With Step Mom
File: zfgdinatahecorcha1jxexctdfu.mp4
Size: 1.54 GB
Duration: 33:14
Resolution: 1920x1080
Format: mp4
Description: No Description Available
Taboo Heat - Amiee Cambridge & Tara Blackwell - Hot New Neighbor P2-3
File: lwj7onataheamitartjpke7jvqg.mp4
Size: 1.53 GB
Duration: 41:28
Resolution: 1920x1080
Format: mp4
Description: Am I Fuckable-
I Luke Longly hear a knock at my bedroom door, and a red headed woman that I've never seen before walks in. 'Hi! I Tara Blackwell just moved in next door!' she tells me. 'Okay, but why are you in my bedroom dressed in a bikini?!' I ask her. 'I just met your step Aunt Amiee Cambridge and she thought it would be a good idea if I came up here and asked you if I was still hot,' she tells me. 'Yeah, I guess so,' I tell her. She pulls her bikini top off and she shows me her real tits. 'Wow! My step-mom and my step Aunt both have big, fake tits. I haven't seen real tits in a really long time,' I confess. She climbs onto my bed with me and I reach forward and grab her tits. Then she asks me if she can give me a blowjob, and how could I say no to that? She puts my cock in her mouth and she sucks on my cock until I am nice and hard...
Then she lies down on the bed and I tell her to rub her clit for me. Then I start to fuck her pussy in the missionary position. A few minutes later, she moves into the doggystyle position and I continue to fuck her pussy from behind. She moves back into the missionary position and her natural tits bounce up and down with every thrust. While I am fucking the new neighbor's pussy, my step Aunt Amiee walks into the room. 'I would like it if you guys shared it with me! Why don't you follow me to my bedroom where we can continue?!' Amiee insists. 'Okay! Lead the way!' I say to my step Aunt.
First Threesome-
Our new neighbor and I follow my step Aunt Amiee into her bedroom. 'You said that I'm tighter than your step-mom, so I'm wondering if I'm also tighter than our new neighbor,' Amiee says to me. Amiee spreads Tara's legs open wide, and she starts to rub Tara's clit. Then Amiee crawls over to me and she starts to give me a blowjob. Tara joins in and she starts to suck my cock as well. After they give me a double blowjob, Amiee starts to eat Tara's pussy out. Amiee is in the doggystyle position while she's going down on our new neighbor, so I start to fuck Amiee's pussy from behind at the same time. I gently play with my step Aunt's ass hole while I'm fucking her pussy. Then I move over to Tara and I start to fuck her pussy in the missionary position. 'Your ex-husbands loss is our gain!' Amiee giggles. I have the two MILF's move into the doggystyle position next to each other, and they kiss each other while I fuck them from behind. I move back and forth between both of their pussies. Then they both flip over into the missionary position and I continue to fuck their pussies while they kiss each other. 'Do I get to cum in both of your mouths?' I ask them. 'You can cum wherever you want!' my step Aunt replies. I want to cum in their mouths, so I have them put their faces next to each other. When I am ready to cum, I pull my cock out of our new neighbor's pussy and I jerk my cock off into my new neighbor's mouth, and all over my step Aunt's face! Then they kiss each other and swap my cum!
I Luke Longly hear a knock at my bedroom door, and a red headed woman that I've never seen before walks in. 'Hi! I Tara Blackwell just moved in next door!' she tells me. 'Okay, but why are you in my bedroom dressed in a bikini?!' I ask her. 'I just met your step Aunt Amiee Cambridge and she thought it would be a good idea if I came up here and asked you if I was still hot,' she tells me. 'Yeah, I guess so,' I tell her. She pulls her bikini top off and she shows me her real tits. 'Wow! My step-mom and my step Aunt both have big, fake tits. I haven't seen real tits in a really long time,' I confess. She climbs onto my bed with me and I reach forward and grab her tits. Then she asks me if she can give me a blowjob, and how could I say no to that? She puts my cock in her mouth and she sucks on my cock until I am nice and hard...
Then she lies down on the bed and I tell her to rub her clit for me. Then I start to fuck her pussy in the missionary position. A few minutes later, she moves into the doggystyle position and I continue to fuck her pussy from behind. She moves back into the missionary position and her natural tits bounce up and down with every thrust. While I am fucking the new neighbor's pussy, my step Aunt Amiee walks into the room. 'I would like it if you guys shared it with me! Why don't you follow me to my bedroom where we can continue?!' Amiee insists. 'Okay! Lead the way!' I say to my step Aunt.
First Threesome-
Our new neighbor and I follow my step Aunt Amiee into her bedroom. 'You said that I'm tighter than your step-mom, so I'm wondering if I'm also tighter than our new neighbor,' Amiee says to me. Amiee spreads Tara's legs open wide, and she starts to rub Tara's clit. Then Amiee crawls over to me and she starts to give me a blowjob. Tara joins in and she starts to suck my cock as well. After they give me a double blowjob, Amiee starts to eat Tara's pussy out. Amiee is in the doggystyle position while she's going down on our new neighbor, so I start to fuck Amiee's pussy from behind at the same time. I gently play with my step Aunt's ass hole while I'm fucking her pussy. Then I move over to Tara and I start to fuck her pussy in the missionary position. 'Your ex-husbands loss is our gain!' Amiee giggles. I have the two MILF's move into the doggystyle position next to each other, and they kiss each other while I fuck them from behind. I move back and forth between both of their pussies. Then they both flip over into the missionary position and I continue to fuck their pussies while they kiss each other. 'Do I get to cum in both of your mouths?' I ask them. 'You can cum wherever you want!' my step Aunt replies. I want to cum in their mouths, so I have them put their faces next to each other. When I am ready to cum, I pull my cock out of our new neighbor's pussy and I jerk my cock off into my new neighbor's mouth, and all over my step Aunt's face! Then they kiss each other and swap my cum!
Taboo Heat - Amiee Cambridge & Tara Blackwell - Hot New Neighbor P1
File: hzg3ynataheamitarke4592okzz.mp4
Size: 698.86 MB
Duration: 18:05
Resolution: 1920x1080
Format: mp4
Description: Confidence Boost-
My step Aunt Amiee Cambridge hears a knock at the door, so she runs over to answer it. 'Hi, I'm your new neighbor!' Tara Blackwell says. Tara has long, red hair and she is wearing a green dress. Amiee is wearing a bikini and she invites Tara to join her out by the pool. But first, Amiee brings Tara into her bedroom to show her her new bikinis. Amiee is currently wearing a dark purple bikini, but she has three more bikinis spread out across her bed. Amiee hands Tara a green bikini and she tells her to try it on. 'So how are you liking the neighborhood?'Amiee asks her. 'Well, I just got divorced and now I'm trying to get back out there,' Tara explains. 'Wow, look at those tits!' Amiee gasps, after Tara puts the green bikini top on...
Tara puts her bikini bottoms on next, while she tells Amiee that her husband cheated on her and that's what led to the divorce. 'Would you be interested in trying out a younger man? Having some fun with a younger man? I have someone in mind for you,' Amiee tells her new neighbor. 'I would also love to play with you,' Amiee says, as she moves closer to Tara. Amiee starts to kiss Tara and then she playfully shoves Tara onto her bed. Amiee pulls Tara's bikini top to the side, and she starts to lick and suck on her tits. 'That feels so good! Wow!' Tara gasps. Amiee pulls Tara's bikini bottoms off and she starts to eat her pussy out. She eats her new neighbor's pussy out until she cums in her mouth. Tara wants to return the favor, so she offers to eat Amiee's pussy out next. Amiee moves into the doggystyle position and Tara eats her pussy and ass out from behind. Then Amiee moves into the missionary position and Tara continues to eat her pussy out. Then Tara climbs on top of Amiee and they start to 69 each other. 'Would you be interested in meeting my step-nephew? His stamina is on another level!' Amiee tells Tara. 'I would be interested!' Tara responds. 'Let's go find him!' Amiee giggles.
My step Aunt Amiee Cambridge hears a knock at the door, so she runs over to answer it. 'Hi, I'm your new neighbor!' Tara Blackwell says. Tara has long, red hair and she is wearing a green dress. Amiee is wearing a bikini and she invites Tara to join her out by the pool. But first, Amiee brings Tara into her bedroom to show her her new bikinis. Amiee is currently wearing a dark purple bikini, but she has three more bikinis spread out across her bed. Amiee hands Tara a green bikini and she tells her to try it on. 'So how are you liking the neighborhood?'Amiee asks her. 'Well, I just got divorced and now I'm trying to get back out there,' Tara explains. 'Wow, look at those tits!' Amiee gasps, after Tara puts the green bikini top on...
Tara puts her bikini bottoms on next, while she tells Amiee that her husband cheated on her and that's what led to the divorce. 'Would you be interested in trying out a younger man? Having some fun with a younger man? I have someone in mind for you,' Amiee tells her new neighbor. 'I would also love to play with you,' Amiee says, as she moves closer to Tara. Amiee starts to kiss Tara and then she playfully shoves Tara onto her bed. Amiee pulls Tara's bikini top to the side, and she starts to lick and suck on her tits. 'That feels so good! Wow!' Tara gasps. Amiee pulls Tara's bikini bottoms off and she starts to eat her pussy out. She eats her new neighbor's pussy out until she cums in her mouth. Tara wants to return the favor, so she offers to eat Amiee's pussy out next. Amiee moves into the doggystyle position and Tara eats her pussy and ass out from behind. Then Amiee moves into the missionary position and Tara continues to eat her pussy out. Then Tara climbs on top of Amiee and they start to 69 each other. 'Would you be interested in meeting my step-nephew? His stamina is on another level!' Amiee tells Tara. 'I would be interested!' Tara responds. 'Let's go find him!' Amiee giggles.
Taboo Heat - Amiee Cambridge - Step Son Deploys Unloaded
File: cwmpfnataheamicamx7xlhxjabs.mp4
Size: 1.03 GB
Duration: 26:05
Resolution: 1920x1080
Format: mp4
Description: Brennan Rush is upset that he is going to war, when all he wants is to play video games and jerk off. His step-mom, Amiee Cambridge, comes bursting into his bedroom with a letter from the White House in her hands. 'Why didn't you tell me about this letter?!' she cries. 'First Luke got drafted and now you! This letter says that you have to leave on Friday!' she continues. 'I'm sorry but I didn't know how to tell you about it. I really don't want to go to war,' he tells her.
Amiee is wearing a white dress as she sits down on Brennan's bed, right next to him. He confesses to his step-mom that he is still a virgin, and Amiee feels like her step-son needs to lose his virginity before going off to war. 'I'm going to help you out!' she tells him. Amiee pulls her big tits out from under her white dress, and then she tells him to touch them. 'Just don't tell your father about this! That's the only rule!' she exclaims. 'I've never felt a woman's breast before!' he admits. He starts to lick and suck on her nipples. He lies down on the bed and she pulls his cock out from under his pants. She starts to give him a blowjob. She strips out of her dress, and then she climbs on top of him. She starts to ride his cock in the cowgirl position. She slowly bounces up and down on his cock, to warm him up. Then she licks his cock clean before she moves into the reverse cowgirl position. She moves into the doggystyle position next and he fucks her pussy from behind. She sucks his cock clean again, and then she moves into the missionary position. Amiee lies down on her side next, and he continues to fuck her pussy. 'Fuck my face!' Amiee begs him. He puts his cock in her mouth and he fucks her face just like she wants. Then he goes back to fucking her pussy in the missionary position until he is ready to cum. Then, he pulls his cock out of her pussy and he jerks his cock off into her mouth and on her face! Now he is ready for war!
Amiee is wearing a white dress as she sits down on Brennan's bed, right next to him. He confesses to his step-mom that he is still a virgin, and Amiee feels like her step-son needs to lose his virginity before going off to war. 'I'm going to help you out!' she tells him. Amiee pulls her big tits out from under her white dress, and then she tells him to touch them. 'Just don't tell your father about this! That's the only rule!' she exclaims. 'I've never felt a woman's breast before!' he admits. He starts to lick and suck on her nipples. He lies down on the bed and she pulls his cock out from under his pants. She starts to give him a blowjob. She strips out of her dress, and then she climbs on top of him. She starts to ride his cock in the cowgirl position. She slowly bounces up and down on his cock, to warm him up. Then she licks his cock clean before she moves into the reverse cowgirl position. She moves into the doggystyle position next and he fucks her pussy from behind. She sucks his cock clean again, and then she moves into the missionary position. Amiee lies down on her side next, and he continues to fuck her pussy. 'Fuck my face!' Amiee begs him. He puts his cock in her mouth and he fucks her face just like she wants. Then he goes back to fucking her pussy in the missionary position until he is ready to cum. Then, he pulls his cock out of her pussy and he jerks his cock off into her mouth and on her face! Now he is ready for war!
Taboo Heat - Cory Chase & Gigi Sweets - A Super Hero Parody V2 P2
File: apyyfnatahecorgig7adthrdxi9.mp4
Size: 1.09 GB
Duration: 26:54
Resolution: 1920x1080
Format: mp4
Description: Lustful Code Revealed
Power Gurl and Super Gurl are standing next to each other, and I walk around them, grabbing and feeling up both of their big tits. Power Gurl's big tits are all natural, while Super Gurl's big tits are enhanced and bought I just love the combination of both! 'Where would you like to start first?' I whisper. 'Oral protocol activated,' they both respond. Sounds good to me! I pull my shorts down to the ground, and they both instantly get down on their knees in front of me. When I pull my pants down, it is only then that I realize that the orange and green bags in my pockets must be kryptonite! They both start to give me a double blowjob. Then I make them sit down on the weight bench with their legs spread open wide. I start to fuck Power Gurl's pussy in the missionary position first, and then I fuck Super Gurl's pussy in the same position. I move Super Gurl into the doggystyle position and while I am fucking her pussy from behind, she is eating out Power Gurl's pussy at the same time. Then I have them switch places, and I start to fuck Power Gurl's pussy from behind while she is eating out Super Gurl's pussy out. I flip Power Gurl over into the missionary position so I can watch her big tits bounce up and down with every thrust. I go back to fucking Super Gurl in the doggystyle position next, while she is licking Power Gurl's tits simultaneously. I then fuck Power Gurl's pussy in the doggystyle position while she is eating out Super Gurl's pussy again. 'Yes, master!' they both moan. I ask them to move into the doggystyle position next to each other, and then I move back and forth between fucking each of them from behind. When I am ready to cum, I ask the two super heroines to get down on their knees in front of me and open their mouths wide. Then I jerk my cock off into both of their mouths. 'Super slut robots, power down!' I say once I am finished using them. After they have been powered down, I drop the green kryptonite onto Super Gurl's lap and then I drop the orange kryptonite onto Power Gurl's lap. 'Initiate hard drive deletion sequence now,' I say out loud. 'Give me a five minute head start and then you can reactivate back into super hero mode,' I tell them. 'Initiation sequence activated,' they both say. A moment later, they both are fully online and alert. 'What happened here?!' Power Gurl asks Super Gurl. 'I don't know!' Power Gurl responds. They both don't remember anything that just happened. 'Let's go fight some crime!' Super Gurl exclaims. 'Let's do it!' Power Gurl responds.
Power Gurl and Super Gurl are standing next to each other, and I walk around them, grabbing and feeling up both of their big tits. Power Gurl's big tits are all natural, while Super Gurl's big tits are enhanced and bought I just love the combination of both! 'Where would you like to start first?' I whisper. 'Oral protocol activated,' they both respond. Sounds good to me! I pull my shorts down to the ground, and they both instantly get down on their knees in front of me. When I pull my pants down, it is only then that I realize that the orange and green bags in my pockets must be kryptonite! They both start to give me a double blowjob. Then I make them sit down on the weight bench with their legs spread open wide. I start to fuck Power Gurl's pussy in the missionary position first, and then I fuck Super Gurl's pussy in the same position. I move Super Gurl into the doggystyle position and while I am fucking her pussy from behind, she is eating out Power Gurl's pussy at the same time. Then I have them switch places, and I start to fuck Power Gurl's pussy from behind while she is eating out Super Gurl's pussy out. I flip Power Gurl over into the missionary position so I can watch her big tits bounce up and down with every thrust. I go back to fucking Super Gurl in the doggystyle position next, while she is licking Power Gurl's tits simultaneously. I then fuck Power Gurl's pussy in the doggystyle position while she is eating out Super Gurl's pussy again. 'Yes, master!' they both moan. I ask them to move into the doggystyle position next to each other, and then I move back and forth between fucking each of them from behind. When I am ready to cum, I ask the two super heroines to get down on their knees in front of me and open their mouths wide. Then I jerk my cock off into both of their mouths. 'Super slut robots, power down!' I say once I am finished using them. After they have been powered down, I drop the green kryptonite onto Super Gurl's lap and then I drop the orange kryptonite onto Power Gurl's lap. 'Initiate hard drive deletion sequence now,' I say out loud. 'Give me a five minute head start and then you can reactivate back into super hero mode,' I tell them. 'Initiation sequence activated,' they both say. A moment later, they both are fully online and alert. 'What happened here?!' Power Gurl asks Super Gurl. 'I don't know!' Power Gurl responds. They both don't remember anything that just happened. 'Let's go fight some crime!' Super Gurl exclaims. 'Let's do it!' Power Gurl responds.
Taboo Heat - Cory Chase & Gigi Sweets - A Super Hero Parody V2 P1
File: 18ck8natahecorgigvqk8dyy57r.mp4
Size: 1.50 GB
Duration: 14:08
Resolution: 3840x2160
Format: mp4
Description: Backstory
In the bright, sweat-soaked haze of the abandoned gym--once a bustling fitness center, now a forgotten relic with rusted weights and cracked mirrors--Supergurl and Power Gurl lay sprawled on the cold dirty floor. Their bodies glistened under the flickering fluorescent lights, a tangled mess of torn costumes, smeared makeup, and sticky remnants of their encounter with Detective Sudan. Cum streaked their skin, drying in rivulets across their heaving breasts and thighs, a testament to their utter defeat. Supergurl's skirt was hiked up obscenely, her cape crumpled beneath her like a discarded flag of heroism. Power Gurl's leotard hung in tatters, her famous cleavage exposed and marked with bites and bruises. They breathed shallowly, eyes half-lidded in post-orgasmic stupor, too drained to move, their Kryptonian resilience temporarily shattered by the pink and red kryptonite's lingering effects.
Outside, in the alleyway behind the gym, Un-Lucky Luke shuffled through the trash bins, his extra tight shirt showing off his over developed arms. A small-time crook down on his luck--petty thefts, failed heists, and a string of bad bets had left him homeless and desperate. He'd seen an undercover cop SUV speed away moments ago, its window cracking open just long enough to toss out a couple of small, glowing bags that clinked against the pavement. Curiosity piqued, Luke scooped them up, peering inside to find jagged shards of crystal one set pulsing with a vibrant green hue, the other a swirling mix of orange. 'What the hell are these? Fancy rocks?' he muttered, stuffing them into his pockets. Worth something on the black market, maybe. Hearing faint moans from the gym's shattered side door, he crept inside, drawn by the promise of easy loot or perhaps a score.
Robot Reset
After pocketing the glowing bags of orange and green, I stand up and I walk over to the gym. 'Is that who I think it is?!' I gasp. I walk closer and I find Super Gurl and Power Gurl lying down on the floor. The super heroines are rebooting into robots! They slowly stand up and look towards me. 'Sex Robot initiation complete,' Power Gurl says after she stands up. I have successfully turned them into sex robots! The Kryptonite in my pocket glows. 'No way! You're sex robots now?' I ask them. 'We always have been,' they respond in unison. 'Why don't you two stand up over there?' I ask them. 'Yes, master,' Super Gurl responds. 'Super Gurl, blast Power Gurl in the chest with your heat vision,' I demand. 'Yes, master,' she replies again, as she does what she is told to do. I then ask Power Gurl to blast Super Gurl's pussy with her heat vision, and she does what she is told as well. 'Now get closer and kiss each other,' I ask the super heroines. They move closer and they begin to kiss in front of me. I ask them to freeze, and they freeze! Then I walk over to Super Gurl and I lift her top up, exposing her big tits. I walk over to Power Gurl next and I pull her big tits out from under her top as well. Then I instruct them both to lick and suck on each other's tits. A few minutes later, I instruct Super Gurl to sit down on the weight bench and spread her legs open wide. Then I instruct Power Gurl to eat her pussy out. I walk behind Super Gurl and I start to feel up her big tits while Power Gurl is going down on her. After Super Gurl cums, the two MILF's switch places and I have Power Gurl spread her legs open wide in front of Super Gurl. This time, Super Gurl eats Power Gurl's pussy out until she cums in her mouth.
In the bright, sweat-soaked haze of the abandoned gym--once a bustling fitness center, now a forgotten relic with rusted weights and cracked mirrors--Supergurl and Power Gurl lay sprawled on the cold dirty floor. Their bodies glistened under the flickering fluorescent lights, a tangled mess of torn costumes, smeared makeup, and sticky remnants of their encounter with Detective Sudan. Cum streaked their skin, drying in rivulets across their heaving breasts and thighs, a testament to their utter defeat. Supergurl's skirt was hiked up obscenely, her cape crumpled beneath her like a discarded flag of heroism. Power Gurl's leotard hung in tatters, her famous cleavage exposed and marked with bites and bruises. They breathed shallowly, eyes half-lidded in post-orgasmic stupor, too drained to move, their Kryptonian resilience temporarily shattered by the pink and red kryptonite's lingering effects.
Outside, in the alleyway behind the gym, Un-Lucky Luke shuffled through the trash bins, his extra tight shirt showing off his over developed arms. A small-time crook down on his luck--petty thefts, failed heists, and a string of bad bets had left him homeless and desperate. He'd seen an undercover cop SUV speed away moments ago, its window cracking open just long enough to toss out a couple of small, glowing bags that clinked against the pavement. Curiosity piqued, Luke scooped them up, peering inside to find jagged shards of crystal one set pulsing with a vibrant green hue, the other a swirling mix of orange. 'What the hell are these? Fancy rocks?' he muttered, stuffing them into his pockets. Worth something on the black market, maybe. Hearing faint moans from the gym's shattered side door, he crept inside, drawn by the promise of easy loot or perhaps a score.
Robot Reset
After pocketing the glowing bags of orange and green, I stand up and I walk over to the gym. 'Is that who I think it is?!' I gasp. I walk closer and I find Super Gurl and Power Gurl lying down on the floor. The super heroines are rebooting into robots! They slowly stand up and look towards me. 'Sex Robot initiation complete,' Power Gurl says after she stands up. I have successfully turned them into sex robots! The Kryptonite in my pocket glows. 'No way! You're sex robots now?' I ask them. 'We always have been,' they respond in unison. 'Why don't you two stand up over there?' I ask them. 'Yes, master,' Super Gurl responds. 'Super Gurl, blast Power Gurl in the chest with your heat vision,' I demand. 'Yes, master,' she replies again, as she does what she is told to do. I then ask Power Gurl to blast Super Gurl's pussy with her heat vision, and she does what she is told as well. 'Now get closer and kiss each other,' I ask the super heroines. They move closer and they begin to kiss in front of me. I ask them to freeze, and they freeze! Then I walk over to Super Gurl and I lift her top up, exposing her big tits. I walk over to Power Gurl next and I pull her big tits out from under her top as well. Then I instruct them both to lick and suck on each other's tits. A few minutes later, I instruct Super Gurl to sit down on the weight bench and spread her legs open wide. Then I instruct Power Gurl to eat her pussy out. I walk behind Super Gurl and I start to feel up her big tits while Power Gurl is going down on her. After Super Gurl cums, the two MILF's switch places and I have Power Gurl spread her legs open wide in front of Super Gurl. This time, Super Gurl eats Power Gurl's pussy out until she cums in her mouth.
Taboo Heat - Amiee Cambridge & Melanie Hicks - The Satisfied Step Sister
File: skqjpnataheamimel3xn8ohgdgq.mp4
Size: 1.52 GB
Duration: 43:11
Resolution: 1920x1080
Format: mp4
Description: Melanie is sitting down on the bed, and she is wearing a pink dress, when Amiee walks into her bedroom. 'I've never seen you look so down! What's on your mind?!' Amiee asks her step-sister, as she sits down next to her. 'I just feel like I'm not satisfied, lately,' Melanie says. 'That's why I became a size queen!' Amiee giggles. 'I am too tight! How do I loosen up?' Melanie asks Amiee. 'You need to practice stretching out! I could invite a friend over for us,' Amiee tells her.
Amiee picks up her phone and she sends a text to one of her guy friends. 'Now let's get you warmed up,' Amiee says to Melanie. She leans in to kiss her, and Amiee pulls Melanie's big natural tits out from under her dress. Amiee licks and sucks on her step-sister's nipples. Melanie leans back on the bed and she spreads her legs open wide in front of Amiee. Then Amiee eats her step-sister's pussy out until she cums in her mouth. Then the two MILF's rub each other's clits with their fingers. Melanie starts to eat Amiee's pussy out, when Amiee's friend Kaby arrives! He walks into the room and he immediately joins the MILF's by eating Melanie's pussy and ass out from behind, while Melanie is going down on Amiee. A few minutes later, Kaby lies down on the bed and Amiee and Melanie both start to suck his cock. His BBC is so huge that it can barely fit in their mouths. Melanie sits down on Kaby's face and Amiee sits down on Kaby's cock at the same time. Amiee bounces up and down on his cock, and then when she climbs off of him, she sucks on his cock for a minute. Then Melanie climbs on top of Kaby's cock and she rides him in the cowgirl position. Melanie and Amiee lie down on the bed in the missionary position and Kaby goes back and forth between fucking their pussy's. He eats Melanie's pussy out next, while Amiee sucks on her step-sister's nipples. Amiee moves into the doggystyle position and Kaby eats her pussy and ass out from behind before he fucks her pussy. He fucks Melanie's pussy from behind next, before Amiee licks his cock clean. Then Kaby goes back to fucking Melanie's pussy in the doggystyle position some more. When he is ready to cum, he pulls his cock out of Melanie's pussy and he jerks his cock off into her mouth!
Amiee picks up her phone and she sends a text to one of her guy friends. 'Now let's get you warmed up,' Amiee says to Melanie. She leans in to kiss her, and Amiee pulls Melanie's big natural tits out from under her dress. Amiee licks and sucks on her step-sister's nipples. Melanie leans back on the bed and she spreads her legs open wide in front of Amiee. Then Amiee eats her step-sister's pussy out until she cums in her mouth. Then the two MILF's rub each other's clits with their fingers. Melanie starts to eat Amiee's pussy out, when Amiee's friend Kaby arrives! He walks into the room and he immediately joins the MILF's by eating Melanie's pussy and ass out from behind, while Melanie is going down on Amiee. A few minutes later, Kaby lies down on the bed and Amiee and Melanie both start to suck his cock. His BBC is so huge that it can barely fit in their mouths. Melanie sits down on Kaby's face and Amiee sits down on Kaby's cock at the same time. Amiee bounces up and down on his cock, and then when she climbs off of him, she sucks on his cock for a minute. Then Melanie climbs on top of Kaby's cock and she rides him in the cowgirl position. Melanie and Amiee lie down on the bed in the missionary position and Kaby goes back and forth between fucking their pussy's. He eats Melanie's pussy out next, while Amiee sucks on her step-sister's nipples. Amiee moves into the doggystyle position and Kaby eats her pussy and ass out from behind before he fucks her pussy. He fucks Melanie's pussy from behind next, before Amiee licks his cock clean. Then Kaby goes back to fucking Melanie's pussy in the doggystyle position some more. When he is ready to cum, he pulls his cock out of Melanie's pussy and he jerks his cock off into her mouth!
Taboo Heat - Cory Chase & Amiee Cambridge - Milf Sluts In The Big City P2
File: 2xwzznatahecoramisnroerf3ky.mp4
Size: 1.23 GB
Duration: 30:24
Resolution: 1920x1080
Format: mp4
Description: Rise and Grind-
Cory Chase and Amiee Cambridge walk into the hotel room and look directly at me Luke Longly. 'Are you ready for us?' my step-mom, Cory, asks me. 'We are ready for you!' my step Aunt Amiee says. Cory climbs onto the bed and Amiee pulls Cory's high heels off of her feet. I climb onto the bed with them, and they both pull my shorts off, revealing my cock.
They both start to give me a double blowjob, and I reach out to play with Cory's big tits at the same time. Once my cock is nice and hard, Cory climbs on top of me and she starts to ride my cock in the cowgirl position. A few minutes later, Cory hops off of my cock and Amiee sucks my cock clean before Amiee gets on top of me next. Amiee rides my cock in the cowgirl position while Cory watches us and licks Amiee's nipples. They both suck my cock again before they both move into the missionary position at the edge of the bed. I start to fuck Cory's pussy while Amiee is playing with her step-sister's big tits. I move over to Amiee's pussy next and I fuck her pussy in the missionary position next. I move back over to Cory's pussy and I continue to fuck my step-mom some more. Amiee moves into the doggystyle position at the edge of the bed and Cory holds Amiee's ass open while I'm fucking her pussy. Cory then moves in front of Amiee so Amiee can eat Cory's pussy out while I'm fucking Amiee's pussy from behind. Amiee moves back into the missionary position and I continue fucking her tight pussy. Cory then moves into the doggystyle position and Amiee holds Cory's ass while I'm fucking her pussy from behind. When I am getting close to cumming, I have Amiee move into the missionary position and I keep fucking her pussy harder and faster now. Then I allow my cock to explode deep inside of Amiee's pussy, because she wants me to creampie her! Some of my cum drips out of Amiee's pussy and Cory licks it all up!
Cory Chase and Amiee Cambridge walk into the hotel room and look directly at me Luke Longly. 'Are you ready for us?' my step-mom, Cory, asks me. 'We are ready for you!' my step Aunt Amiee says. Cory climbs onto the bed and Amiee pulls Cory's high heels off of her feet. I climb onto the bed with them, and they both pull my shorts off, revealing my cock.
They both start to give me a double blowjob, and I reach out to play with Cory's big tits at the same time. Once my cock is nice and hard, Cory climbs on top of me and she starts to ride my cock in the cowgirl position. A few minutes later, Cory hops off of my cock and Amiee sucks my cock clean before Amiee gets on top of me next. Amiee rides my cock in the cowgirl position while Cory watches us and licks Amiee's nipples. They both suck my cock again before they both move into the missionary position at the edge of the bed. I start to fuck Cory's pussy while Amiee is playing with her step-sister's big tits. I move over to Amiee's pussy next and I fuck her pussy in the missionary position next. I move back over to Cory's pussy and I continue to fuck my step-mom some more. Amiee moves into the doggystyle position at the edge of the bed and Cory holds Amiee's ass open while I'm fucking her pussy. Cory then moves in front of Amiee so Amiee can eat Cory's pussy out while I'm fucking Amiee's pussy from behind. Amiee moves back into the missionary position and I continue fucking her tight pussy. Cory then moves into the doggystyle position and Amiee holds Cory's ass while I'm fucking her pussy from behind. When I am getting close to cumming, I have Amiee move into the missionary position and I keep fucking her pussy harder and faster now. Then I allow my cock to explode deep inside of Amiee's pussy, because she wants me to creampie her! Some of my cum drips out of Amiee's pussy and Cory licks it all up!
Taboo Heat - Cory Chase & Amiee Cambridge - Milf Sluts In The Big City P1
File: w9s2knatahecoramijk7i4ycdeh.mp4
Size: 462.51 MB
Duration: 12:21
Resolution: 1920x1080
Format: mp4
Description: Warm Up Stretch- My step-mom, Cory Chase, is walking through the big city with her suitcase in her hand! When she arrives at the hotel, she meets up with her step-sister, Amiee Cambridge. Cory is wearing a blue dress, and Amiee has a coat on with no shirt underneath! They both pull their big tits out as they arrive at their hotel room. They walk into the hotel bathroom together and Cory starts to lick and suck on Amiee's nipples. Then they start to make out with each other. Amiee gets down on her knees and she starts to eat Cory's pussy out next. Amiee sits down on the edge of the bathroom sink and Cory continues to eat her pussy out. A few minutes later, Amiee stands up and she moves into the doggystyle position against the bathroom counter, and Cory eats her pussy and ass out from behind. 'We are now ready to get stretched out,' Amiee says as she looks at me.
Taboo Heat - Cory Chase - Hotel Room Service Special
File: h5er4natahecorchaw1f7oeejcd.mp4
Size: 1.35 GB
Duration: 38:34
Resolution: 1920x1080
Format: mp4
Description: 'What do you think?' My step-mom, Cory Chase, asks me as she walks into the room. She is wearing a white dress, and she is curious to know if I Luke Longly like it. 'Why are you dressing like that?! I just want to go to the theme park and the arcade!' I tell her. 'I have to take care of some favors. I have to do some work, but afterwards we can go to the theme park,' she tells me. 'How many favors do you have to take care of today?!' I cry. 'A few! But maybe you could help me relax before I leave,' she suggests. She unzips her dress, and she pulls her big, enhanced tits out from under her dress. She takes her dress off completely, and she has a dark pink thong on that matches her high heels. 'I am offering my body up to you! So what do you say?' she asks me. She pulls her panties off and she shoves her ass in my face. It is very hard to say no to this offer...
'Why don't you lay down and I will take care of you,' she says. I lie down on the bed and she pulls my shorts off. She starts to give me a blowjob. 'This is more fun than watching boring TV shows,' I confess. After she sucks my cock for a few more minutes, she climbs on top of me and she starts to ride my cock in the cowgirl position. I reach up and I grab her big tits while I fuck her. My step-dad recently paid for her to get even bigger, enhanced tits and I love playing with them! 'I just love riding your hard cock,' she moans. 'Do you want to do this with me on all my business trips. When I need to do favors,' she asks me. 'As long as I am first and late,' I tell her. I assume that the favors she is talking about, is that she is fucking other men. She flips over into the reverse cowgirl position and she continues to ride my cock. She lies down on the bed in the missionary position next, and I continue to fuck her pussy. 'If you want to fuck my ass, you can!' she tells me. I move my cock out of her pussy and immediately into her ass hole, because how could I say no to that offer? I go back and forth between fucking her ass and her pussy. She moves into the doggystyle position next, and I continue to fuck her ass and pussy in no particular order. 'Is it time for you to go on your first 'favor'?' I ask her. 'Yes, it is!' she says, as she gets up. 'I will be back in a few hours, so be ready to fuck me again when I get back! And then we will go to the parks!' she exclaims.
Step Mom Reclaimed-
My step-mom just got back to the hotel room, and the first thing that she does is strip out of her white dress. Once she is naked, she hops onto the bed and she tells me 'Sweetheart, I'm ready!!' She starts to give me a blowjob, while telling me that she wants me to cum inside of her pussy today. She sucks my cock for a few minutes, and then I start to finger her pussy. She is lying down on the bed in the missionary position when I start to fuck her pussy. A few moments later, I move my cock out of her pussy and into her ass hole. She climbs on top of me and she rides my cock in the cowgirl position. She moves my cock into her asshole and she continues to bounce up and down on my hard cock. She sucks my cock clean, and then she rides my ass hole some more. 'I can't tell if I like your cock in my pussy or my ass more!' she tells me, as she keeps switching which hole she is using. She lies down in the missionary position and I keep fucking her pussy until I am ready to cum. Then I creampie her pussy, just like she wanted! 'You really filled me up!' she gasps. 'I want to go to the theme park now!' I demand. 'Let's go!' she says
'Why don't you lay down and I will take care of you,' she says. I lie down on the bed and she pulls my shorts off. She starts to give me a blowjob. 'This is more fun than watching boring TV shows,' I confess. After she sucks my cock for a few more minutes, she climbs on top of me and she starts to ride my cock in the cowgirl position. I reach up and I grab her big tits while I fuck her. My step-dad recently paid for her to get even bigger, enhanced tits and I love playing with them! 'I just love riding your hard cock,' she moans. 'Do you want to do this with me on all my business trips. When I need to do favors,' she asks me. 'As long as I am first and late,' I tell her. I assume that the favors she is talking about, is that she is fucking other men. She flips over into the reverse cowgirl position and she continues to ride my cock. She lies down on the bed in the missionary position next, and I continue to fuck her pussy. 'If you want to fuck my ass, you can!' she tells me. I move my cock out of her pussy and immediately into her ass hole, because how could I say no to that offer? I go back and forth between fucking her ass and her pussy. She moves into the doggystyle position next, and I continue to fuck her ass and pussy in no particular order. 'Is it time for you to go on your first 'favor'?' I ask her. 'Yes, it is!' she says, as she gets up. 'I will be back in a few hours, so be ready to fuck me again when I get back! And then we will go to the parks!' she exclaims.
Step Mom Reclaimed-
My step-mom just got back to the hotel room, and the first thing that she does is strip out of her white dress. Once she is naked, she hops onto the bed and she tells me 'Sweetheart, I'm ready!!' She starts to give me a blowjob, while telling me that she wants me to cum inside of her pussy today. She sucks my cock for a few minutes, and then I start to finger her pussy. She is lying down on the bed in the missionary position when I start to fuck her pussy. A few moments later, I move my cock out of her pussy and into her ass hole. She climbs on top of me and she rides my cock in the cowgirl position. She moves my cock into her asshole and she continues to bounce up and down on my hard cock. She sucks my cock clean, and then she rides my ass hole some more. 'I can't tell if I like your cock in my pussy or my ass more!' she tells me, as she keeps switching which hole she is using. She lies down in the missionary position and I keep fucking her pussy until I am ready to cum. Then I creampie her pussy, just like she wanted! 'You really filled me up!' she gasps. 'I want to go to the theme park now!' I demand. 'Let's go!' she says
Taboo Heat - Cory Chase & Gigi Sweets - Super Sex Battle A Super Hero Parody P1
File: 39km3natahecorgigtamtedtlks.mp4
Size: 643.18 MB
Duration: 17:27
Resolution: 1920x1080
Format: mp4
Description: Backstory-
In the shadowed underbelly of Urban Decay on the wrong side of the tracks, where the neon lights flickered like distant stars, Supergurl Cory Chase and Power Gurl Gigi Sweets faced off in an abandoned warehouse. The air was thick with tension, not from a typical superhero brawl, but from a twisted challenge born of rivalry and hidden desires.
Both women, alternate versions of Kara from different dimensions, had long harbored a competitive spark--Supergurl, the youthful, idealistic cousin of Super Dude, clad in her iconic blue-and-red skirt ensemble Power Gurl, the bolder, more voluptuous counterpart from Earth-Two, her white leotard with the infamous boob window hugging her curves like a second skin. Tonight, that spark ignited into a 'sex battle,' a forbidden contest to see who could dominate the other through sheer erotic prowess, pushing boundaries until one submitted.
Kissing Step Cousins-
'Detective Sudan, I need you to do me a favor!' Super Gurl says. She just appeared next to his car out of thin air. 'Super gurl?! Where did you come from?!' he gasps. She ignores the question, and she hands him a piece of orange kryptonite. 'Take this!' she says, as she thrusts it into his hands. 'This kryptonite doesn't affect me, but it will affect my step cousin, Power Gurl!' she explains. 'I need you to bring that to the gym at 315! I will be having a sex battle with her and this orange kryptonite will make her extra horny,' she continues to explain. The next thing he knows, Super Gurl disappears into thin air! A few moments later, Power Gurl appears next to the detective's car. 'I'm about to have a sex battle with my step cousin and I have this green kryptonite. If you give this to her, this will switch our powers and it will make her more sexually vulnerable,' she explains. 'Please bring this to the gym at 315,' she says to him, right before she vanishes into thin air. Once he is alone in the car, he pulls a box out from the back seat. 'I've got something else for them today!' he laughs to himself.
At 300, Super Gurl and Power Gurl meet in the gym for their sex battle. 'No powers at first, just our hands, our lips and our pussy's,' Super Gurl explains. They start to kiss each other, and then Power Gurl starts to rub Super Gurl's clit. Power Gurl decides to use her powers and Super Gurl flies across the room and into the wall. Power Gurl walks over to the wall and she continues to make out with Super Gurl. All of a sudden, Super Gurl grabs Power Gurl by her throat and she throws her across the room. Super Gurl walks over to where Power Gurl landed and they continue to kiss each other. They start to scissor each other, and they both pull their tits out from under their outfits. 'I lied about not using powers, by the way!' Super Gurl exclaims. Super Gurl uses her magic powers and suddenly Power Gurls panties are gone! Super Gurl then starts to eat Power Gurl's pussy out. 'Say that I am more powerful than you are! Say it!' Super Gurl demands. 'I will never say it!' Power Gurl cries. Super Gurl continues to eat Power Gurl's pussy out. Then they switch places and Power Gurl eats Super Gurl's pussy out this time. Power Gurl stands up and she uses her magical powers on Super Gurl's pussy. 'Now that pussy is mine!' she exclaims, as she goes back to eating her pussy out.
In the shadowed underbelly of Urban Decay on the wrong side of the tracks, where the neon lights flickered like distant stars, Supergurl Cory Chase and Power Gurl Gigi Sweets faced off in an abandoned warehouse. The air was thick with tension, not from a typical superhero brawl, but from a twisted challenge born of rivalry and hidden desires.
Both women, alternate versions of Kara from different dimensions, had long harbored a competitive spark--Supergurl, the youthful, idealistic cousin of Super Dude, clad in her iconic blue-and-red skirt ensemble Power Gurl, the bolder, more voluptuous counterpart from Earth-Two, her white leotard with the infamous boob window hugging her curves like a second skin. Tonight, that spark ignited into a 'sex battle,' a forbidden contest to see who could dominate the other through sheer erotic prowess, pushing boundaries until one submitted.
Kissing Step Cousins-
'Detective Sudan, I need you to do me a favor!' Super Gurl says. She just appeared next to his car out of thin air. 'Super gurl?! Where did you come from?!' he gasps. She ignores the question, and she hands him a piece of orange kryptonite. 'Take this!' she says, as she thrusts it into his hands. 'This kryptonite doesn't affect me, but it will affect my step cousin, Power Gurl!' she explains. 'I need you to bring that to the gym at 315! I will be having a sex battle with her and this orange kryptonite will make her extra horny,' she continues to explain. The next thing he knows, Super Gurl disappears into thin air! A few moments later, Power Gurl appears next to the detective's car. 'I'm about to have a sex battle with my step cousin and I have this green kryptonite. If you give this to her, this will switch our powers and it will make her more sexually vulnerable,' she explains. 'Please bring this to the gym at 315,' she says to him, right before she vanishes into thin air. Once he is alone in the car, he pulls a box out from the back seat. 'I've got something else for them today!' he laughs to himself.
At 300, Super Gurl and Power Gurl meet in the gym for their sex battle. 'No powers at first, just our hands, our lips and our pussy's,' Super Gurl explains. They start to kiss each other, and then Power Gurl starts to rub Super Gurl's clit. Power Gurl decides to use her powers and Super Gurl flies across the room and into the wall. Power Gurl walks over to the wall and she continues to make out with Super Gurl. All of a sudden, Super Gurl grabs Power Gurl by her throat and she throws her across the room. Super Gurl walks over to where Power Gurl landed and they continue to kiss each other. They start to scissor each other, and they both pull their tits out from under their outfits. 'I lied about not using powers, by the way!' Super Gurl exclaims. Super Gurl uses her magic powers and suddenly Power Gurls panties are gone! Super Gurl then starts to eat Power Gurl's pussy out. 'Say that I am more powerful than you are! Say it!' Super Gurl demands. 'I will never say it!' Power Gurl cries. Super Gurl continues to eat Power Gurl's pussy out. Then they switch places and Power Gurl eats Super Gurl's pussy out this time. Power Gurl stands up and she uses her magical powers on Super Gurl's pussy. 'Now that pussy is mine!' she exclaims, as she goes back to eating her pussy out.
Taboo Heat - Gigi Sweets & Cory Chase - Super Sex Battle A Super Hero Parody P2
File: k6n7bnatahegigcorbdcdrbt8zk.mp4
Size: 1.14 GB
Duration: 30:25
Resolution: 1920x1080
Format: mp4
Description: Shared Surrender-
315 has arrived, so Detective Don Sudan walks into the gym where Power Gurl Gigi Sweets and Super Gurl Cory Chase are having their sex battle. Detective Sudan is holding an ancient book in his hands. The ancient book contains a hybrid mix of kryptonite that over powers and overwhelms both Super Gurl and Power Gurl. 'What is happening to us?!' they both gasp. They both grab their pussy's and then they fall to the floor. He holds the book open in front of the MILF's on the floor, and they are unable to control themselves.
They start gasping and shaking. 'I've never been this horny before in my entire life!' Super Gurl exclaims. They both crawl on the floor over to the detective, and when they arrive at his cock, Super Gurl gasps 'I must have it!' She pulls his BBC out from under his pants, and they immediately start to give him a double blowjob. They simply cannot control their urges! Super Gurl and Power Gurl lie down next to each other on the bench and the detective takes turns between fucking both of their pussy's. 'I've never been this horny in my life!' Power Gurl moans while he fucks her. Super Gurl sucks on Power Gurl's nipples while the detective is fucking her pussy. After she cums on his cock, he moves back over to Power Gurl and he fucks her pussy until she cums on his cock as well. Super Gurl pulls his BBC out of Power Gurl's pussy and she sucks his cock clean. Then they both move into the doggystyle position on the bench, and he starts with fucking Super Gurl from behind. Then he moves over to fucking Power Gurl's pussy from behind until she cums on his cock a second time. Power Gurl climbs on top of Super Gurl so that their asses and pussy's are facing Detective Sudan. Then he goes back and forth between fucking them both. While he is fucking Super Gurl, he finger fucks Power Gurl at the same time. Then, Super Gurl lies down in the missionary position on the weight bench and the detective fucks her while Power Gurl's huge, natural tits are in Super Gurl's mouth. 'I can feel my powers depleting when you suck on my nipples!' Power Gurl moans. 'That big, black cock is rearranging my super guts!' Cory gasps. Power Gurl decides to sit on Super Gurl's face while the detective is fucking Super Gurl. 'I want the cum out of that BBC!' Super Gurl moans. 'Why don't you fuck her pussy until you're ready to cum, and then cum in my mouth?!' Super Gurl begs Detective Sudan. Super Gurl gets down on her knees on the floor, next to Power Gurl who is lying down in the missionary position getting fucked by Detective Sudan. When he is ready to cum, Power Gurl climbs down onto her knees next to Super Gurl and they both open their mouths wide. He cums in both of their mouths, and they both swallow it all!
315 has arrived, so Detective Don Sudan walks into the gym where Power Gurl Gigi Sweets and Super Gurl Cory Chase are having their sex battle. Detective Sudan is holding an ancient book in his hands. The ancient book contains a hybrid mix of kryptonite that over powers and overwhelms both Super Gurl and Power Gurl. 'What is happening to us?!' they both gasp. They both grab their pussy's and then they fall to the floor. He holds the book open in front of the MILF's on the floor, and they are unable to control themselves.
They start gasping and shaking. 'I've never been this horny before in my entire life!' Super Gurl exclaims. They both crawl on the floor over to the detective, and when they arrive at his cock, Super Gurl gasps 'I must have it!' She pulls his BBC out from under his pants, and they immediately start to give him a double blowjob. They simply cannot control their urges! Super Gurl and Power Gurl lie down next to each other on the bench and the detective takes turns between fucking both of their pussy's. 'I've never been this horny in my life!' Power Gurl moans while he fucks her. Super Gurl sucks on Power Gurl's nipples while the detective is fucking her pussy. After she cums on his cock, he moves back over to Power Gurl and he fucks her pussy until she cums on his cock as well. Super Gurl pulls his BBC out of Power Gurl's pussy and she sucks his cock clean. Then they both move into the doggystyle position on the bench, and he starts with fucking Super Gurl from behind. Then he moves over to fucking Power Gurl's pussy from behind until she cums on his cock a second time. Power Gurl climbs on top of Super Gurl so that their asses and pussy's are facing Detective Sudan. Then he goes back and forth between fucking them both. While he is fucking Super Gurl, he finger fucks Power Gurl at the same time. Then, Super Gurl lies down in the missionary position on the weight bench and the detective fucks her while Power Gurl's huge, natural tits are in Super Gurl's mouth. 'I can feel my powers depleting when you suck on my nipples!' Power Gurl moans. 'That big, black cock is rearranging my super guts!' Cory gasps. Power Gurl decides to sit on Super Gurl's face while the detective is fucking Super Gurl. 'I want the cum out of that BBC!' Super Gurl moans. 'Why don't you fuck her pussy until you're ready to cum, and then cum in my mouth?!' Super Gurl begs Detective Sudan. Super Gurl gets down on her knees on the floor, next to Power Gurl who is lying down in the missionary position getting fucked by Detective Sudan. When he is ready to cum, Power Gurl climbs down onto her knees next to Super Gurl and they both open their mouths wide. He cums in both of their mouths, and they both swallow it all!
Taboo Heat - Amiee Cambridge & Lola Valentine - Ass To Titty P2-3
File: cszr8nataheamiloli6hwcjqqze.mp4
Size: 1.65 GB
Duration: 47:40
Resolution: 1920x1080
Format: mp4
Description: Back Door Boob Job
My Step Aunt Amiee and my step cousin Lola are standing in front of me. 'I came here to put the tools in the garage,' I tell them. 'Okay, thanks. Before you go, I have a question for you. Are you a boob man?' Amiee asks me. 'That is a personal question!' I gasp. Amiee continues to ask me, until I finally confess that yes I am a boob man! 'Are you free for the rest of today? I actually wanted to borrow you for something,' Amiee tells me. I ask what she means by that. 'You see, your step cousin Lola really wants bigger tits. Something about anal sex makes tits grow! So, Lola wants to see if you will have anal sex with her, and see if her tits will grow. She doesn't have a boyfriend, so you are the only one who can help us out!' Amiee begs me. 'Okay, I guess we can try it out,' I say. Amiee leads Lola and I into the house...
Amiee has Lola sit down on a chair, and then Amiee pulls Lola's bikini top off. Amiee pulls her own big tits out from under her red top. 'You must have taken a lot of dick in your ass if your tits are that big!' I say to my step aunt Amiee. Lola stands up and Amiee pulls Lola's shorts off. Then Amiee instructs Lola to sit back down on the chair. Amiee starts to eat Lola's pussy out, and then she starts to suck on my cock right after. 'Rub your clit while I get his cock nice and hard,' Amiee tells her step-daughter. I start to fuck Lola's pussy in the missionary position first. A few minutes later, I move my cock out of her pussy and into her ass hole. Amiee moves into the doggystyle position and I fuck her pussy first. Then I ask Lola to spread Amiee's ass cheeks open, and I start to fuck Amiee's ass from behind. Lola moves into the doggystyle position next to Amiee, and I move over to Lola's ass next. Lola moves into the missionary position and I fuck her ass some more. 'So, the next time I see you, your boobs should be bigger?' I ask Lola. 'Her boobs should be a little bigger!' Amiee tells us.
Swallow The Secret Sauce
Lola is looking in the mirror at her tits, to see if they've grown at all since she first tried anal sex. 'Well, anal sex is definitely how you can get your boobs to start growing, but if you really want to make them grow, you need the secret sauce,' Amiee tells Lola. 'What is the secret sauce?!' Lola asks her step-mother. 'Cum! It's best if you swallow it!' Amiee giggles. 'But we didn't do that with step cousin Luke last time!' Lola cries. 'I will call Luke and see if he will come over here and finish what we started,' Amiee tells Lola. Amiee picks up the phone and she calls me. 'We were wondering if you were busy today, or if you could stop by and finish what we started a few weeks ago?' she asks me. I tell her that I will be over shortly! I drive over to Amiee's house, and I tell Lola that I think her boobs are starting to grow. 'We want to make her boobs even bigger though! So, we need more anal sex plus we need you to cum in Lola's mouth and give her the secret sauce,' Amiee tells us. Amiee strips out of her clothing, and then she tells me to bring my cock over to them so they can share it. My step-aunt and step-cousin both start to give me a blowjob. Once my cock is nice and hard, Lola climbs on top of me and she starts to ride my cock in the cowgirl position with her pussy. A few minutes later, she moves my cock into her ass hole while she is still riding me. She climbs off, and Amiee and Lola both suck my cock again. Amiee climbs on top of my cock next, and she rides my cock in the cowgirl position with her pussy first. Lola licks Amiee's nipples while Amiee is riding me. I move my cock into Amiee's ass next, while she is still riding me. They both lick my cock clean again. Then I ask my step aunt and my step cousin to move into the doggystyle position at the edge of the bed, next to each other. They kiss each other, while I go back and forth between fucking all of their holes. When I get close to cumming, I have Lola move into the missionary position and I fuck her ass and pussy back and forth. When I am ready to cum, I jerk my cock off into Lola's mouth and all over her face! 'Good girl! That is how you will grow your tits!' Amiee applauds her.
My Step Aunt Amiee and my step cousin Lola are standing in front of me. 'I came here to put the tools in the garage,' I tell them. 'Okay, thanks. Before you go, I have a question for you. Are you a boob man?' Amiee asks me. 'That is a personal question!' I gasp. Amiee continues to ask me, until I finally confess that yes I am a boob man! 'Are you free for the rest of today? I actually wanted to borrow you for something,' Amiee tells me. I ask what she means by that. 'You see, your step cousin Lola really wants bigger tits. Something about anal sex makes tits grow! So, Lola wants to see if you will have anal sex with her, and see if her tits will grow. She doesn't have a boyfriend, so you are the only one who can help us out!' Amiee begs me. 'Okay, I guess we can try it out,' I say. Amiee leads Lola and I into the house...
Amiee has Lola sit down on a chair, and then Amiee pulls Lola's bikini top off. Amiee pulls her own big tits out from under her red top. 'You must have taken a lot of dick in your ass if your tits are that big!' I say to my step aunt Amiee. Lola stands up and Amiee pulls Lola's shorts off. Then Amiee instructs Lola to sit back down on the chair. Amiee starts to eat Lola's pussy out, and then she starts to suck on my cock right after. 'Rub your clit while I get his cock nice and hard,' Amiee tells her step-daughter. I start to fuck Lola's pussy in the missionary position first. A few minutes later, I move my cock out of her pussy and into her ass hole. Amiee moves into the doggystyle position and I fuck her pussy first. Then I ask Lola to spread Amiee's ass cheeks open, and I start to fuck Amiee's ass from behind. Lola moves into the doggystyle position next to Amiee, and I move over to Lola's ass next. Lola moves into the missionary position and I fuck her ass some more. 'So, the next time I see you, your boobs should be bigger?' I ask Lola. 'Her boobs should be a little bigger!' Amiee tells us.
Swallow The Secret Sauce
Lola is looking in the mirror at her tits, to see if they've grown at all since she first tried anal sex. 'Well, anal sex is definitely how you can get your boobs to start growing, but if you really want to make them grow, you need the secret sauce,' Amiee tells Lola. 'What is the secret sauce?!' Lola asks her step-mother. 'Cum! It's best if you swallow it!' Amiee giggles. 'But we didn't do that with step cousin Luke last time!' Lola cries. 'I will call Luke and see if he will come over here and finish what we started,' Amiee tells Lola. Amiee picks up the phone and she calls me. 'We were wondering if you were busy today, or if you could stop by and finish what we started a few weeks ago?' she asks me. I tell her that I will be over shortly! I drive over to Amiee's house, and I tell Lola that I think her boobs are starting to grow. 'We want to make her boobs even bigger though! So, we need more anal sex plus we need you to cum in Lola's mouth and give her the secret sauce,' Amiee tells us. Amiee strips out of her clothing, and then she tells me to bring my cock over to them so they can share it. My step-aunt and step-cousin both start to give me a blowjob. Once my cock is nice and hard, Lola climbs on top of me and she starts to ride my cock in the cowgirl position with her pussy. A few minutes later, she moves my cock into her ass hole while she is still riding me. She climbs off, and Amiee and Lola both suck my cock again. Amiee climbs on top of my cock next, and she rides my cock in the cowgirl position with her pussy first. Lola licks Amiee's nipples while Amiee is riding me. I move my cock into Amiee's ass next, while she is still riding me. They both lick my cock clean again. Then I ask my step aunt and my step cousin to move into the doggystyle position at the edge of the bed, next to each other. They kiss each other, while I go back and forth between fucking all of their holes. When I get close to cumming, I have Lola move into the missionary position and I fuck her ass and pussy back and forth. When I am ready to cum, I jerk my cock off into Lola's mouth and all over her face! 'Good girl! That is how you will grow your tits!' Amiee applauds her.
Taboo Heat - Amiee Cambridge & Lola Valentine - Ass To Titty P1
File: pripznataheamilolzhf95wn1rt.mp4
Size: 522.73 MB
Duration: 16:30
Resolution: 1920x1080
Format: mp4
Description: Anal Makes Boobs Grow
'Hey step-mom,' Lola says as she walks into the living room and finds Amiee sitting there. Amiee is wearing jean shorts and a tight red, revealing top. Lola is wearing a light pink bikini top, and she has extremely small tits. 'How did you get your boobs to grow?! I wish mine would grow!' Lola cries. 'I am a little embarrassed to say it, but it's because of my anal habit! I just take it in the ass a lot, and it makes my boobs grow,' Amiee explains. 'Wait! Anal sex made your boobs that big?!' Lola asks. 'I don't know how it works, but it does! When I started doing anal, my boobs just started to grow!' Amiee tells her step-daughter. 'Would you like to feel them?' Amiee asks Lola...
Lola leans forward and she starts to feel her big tits. Lola tells her that she wants to try anal sex soon, because she really wants her boobs to grow as well! 'Step-mom, can you show me how to have anal sex?' Lola asks. 'Yes! But you have to warm up first, and use lube!' Amiee tells her. Amiee pulls her step-daughter's bikini top off, and she starts to play with her nipples. Amiee starts to lick Lola's nipples, to warm her up. Amiee pulls her step-daughter's shorts off next, and now Lola is completely naked! 'Why don't you lay back and let your darling step-mom loosen you up?!' Amiee giggles. Lola leans against the table in the doggystyle position, and Amiee starts to eat her pussy and ass out from behind. Lola flips over and while she is standing up, Amiee continues to eat her pussy out. Amiee starts to finger fuck her while she is eating her out. Lola sits down on the chair and Amiee lubes up Lola's ass hole. Amiee slowly sticks a finger in her ass hole to loosen her up. 'We're going to grow those tits!' Amiee exclaims. Amiee then sticks two fingers up Lola's tight ass hole.
'Hey step-mom,' Lola says as she walks into the living room and finds Amiee sitting there. Amiee is wearing jean shorts and a tight red, revealing top. Lola is wearing a light pink bikini top, and she has extremely small tits. 'How did you get your boobs to grow?! I wish mine would grow!' Lola cries. 'I am a little embarrassed to say it, but it's because of my anal habit! I just take it in the ass a lot, and it makes my boobs grow,' Amiee explains. 'Wait! Anal sex made your boobs that big?!' Lola asks. 'I don't know how it works, but it does! When I started doing anal, my boobs just started to grow!' Amiee tells her step-daughter. 'Would you like to feel them?' Amiee asks Lola...
Lola leans forward and she starts to feel her big tits. Lola tells her that she wants to try anal sex soon, because she really wants her boobs to grow as well! 'Step-mom, can you show me how to have anal sex?' Lola asks. 'Yes! But you have to warm up first, and use lube!' Amiee tells her. Amiee pulls her step-daughter's bikini top off, and she starts to play with her nipples. Amiee starts to lick Lola's nipples, to warm her up. Amiee pulls her step-daughter's shorts off next, and now Lola is completely naked! 'Why don't you lay back and let your darling step-mom loosen you up?!' Amiee giggles. Lola leans against the table in the doggystyle position, and Amiee starts to eat her pussy and ass out from behind. Lola flips over and while she is standing up, Amiee continues to eat her pussy out. Amiee starts to finger fuck her while she is eating her out. Lola sits down on the chair and Amiee lubes up Lola's ass hole. Amiee slowly sticks a finger in her ass hole to loosen her up. 'We're going to grow those tits!' Amiee exclaims. Amiee then sticks two fingers up Lola's tight ass hole.
Taboo Heat - Cory Chase & Juniper Ren - Step Daughter Truth Or Dare P3
File: phszmnatahecorjunbomdmgtsmo.mp4
Size: 1.18 GB
Duration: 31:21
Resolution: 1920x1080
Format: mp4
Description: Step Family Bonding- I walk into the bedroom and I find my step-daughter sitting next to my wife. 'We wanted to talk to you about something. I would really love it if we became a free-use family,' my step-daughter, Juniper, admits to me. 'What does that mean?' I ask her. 'It means that you guys can have sex with each other, but you can also have sex with me as well,' she tells me. 'We could have a lot of fun doing that!' she continues. 'I could be okay with that!
So if I want to fuck anyone in this house, I would be allowed to do that?,' Cory responds. 'Yes!' replies Juniper. I've secretly been fucking my step-daughter anyway, and Cory has also secretly been fucking my step-daughter, so now it just wouldn't be a secret anymore. Juniper moves into the doggystyle position and Cory pulls Juniper's shorts and panties off. Juniper lies down on the bed in the missionary position and Cory starts to eat her pussy out. Then Juniper climbs on top of me and she starts to ride my cock in the cowgirl position. Cory stands next to us and Cory is rubbing her clit and rubbing her nipples while she watches us. 'I want to see how you ride his cock,' Juniper says to my wife. Juniper hops off of me, and Cory climbs on top of my hard cock next. Cory rides my cock in the cowgirl position next, and I love watching her big, enhanced tits bouncing up and down as she rides me. Juniper climbs on top of me again, but this time she is in the reverse cowgirl position with her pussy. When she climbs off of me, Cory licks and sucks my cock clean. Juniper lies down on the bed in the missionary position and I fuck her pussy some more. Juniper is sucking on Cory's big tits while I'm fucking her. Juniper flips over into the doggystyle position and while I am fucking her pussy from behind, Juniper is eating Cory's pussy out at the same time. When I get close to cumming, I have Juniper move back into the missionary position. I keep fucking her pussy harder and faster, until I am ready to cum. Then, I jerk my cock off into Juniper's mouth and all over her face! Then she kisses Cory so the two of them can swap my cum!
So if I want to fuck anyone in this house, I would be allowed to do that?,' Cory responds. 'Yes!' replies Juniper. I've secretly been fucking my step-daughter anyway, and Cory has also secretly been fucking my step-daughter, so now it just wouldn't be a secret anymore. Juniper moves into the doggystyle position and Cory pulls Juniper's shorts and panties off. Juniper lies down on the bed in the missionary position and Cory starts to eat her pussy out. Then Juniper climbs on top of me and she starts to ride my cock in the cowgirl position. Cory stands next to us and Cory is rubbing her clit and rubbing her nipples while she watches us. 'I want to see how you ride his cock,' Juniper says to my wife. Juniper hops off of me, and Cory climbs on top of my hard cock next. Cory rides my cock in the cowgirl position next, and I love watching her big, enhanced tits bouncing up and down as she rides me. Juniper climbs on top of me again, but this time she is in the reverse cowgirl position with her pussy. When she climbs off of me, Cory licks and sucks my cock clean. Juniper lies down on the bed in the missionary position and I fuck her pussy some more. Juniper is sucking on Cory's big tits while I'm fucking her. Juniper flips over into the doggystyle position and while I am fucking her pussy from behind, Juniper is eating Cory's pussy out at the same time. When I get close to cumming, I have Juniper move back into the missionary position. I keep fucking her pussy harder and faster, until I am ready to cum. Then, I jerk my cock off into Juniper's mouth and all over her face! Then she kisses Cory so the two of them can swap my cum!
