pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
3

Evil Angel - Jesse Pony - Anal, Cunt Squirt, Creampie

File: 1udgwnaevanjesponna2b6uempi.mp4
Size: 1.73 GB
Duration: 40:11
Resolution: 1920x1080
Format: mp4
Description: Fabulous porn star Jesse Pony wears glamorous lingerie in the opening tease, showing off and caressing her fit body, stripping off her sheer top to reveal her round breasts, and roughly jamming a giant dildo into her wet slit. The nasty girl masturbates to multiple, squirting orgasms, slopping the floor with liquid lust. She hops off the couch and lewdly licks up her mess, referring to herself as a 'bad little bitch'! Jesse welcomes hung stud Jax Slayher with a blowjob, drooling and choking on his lengthy big Black cock. Jax returns the favor with a deep anal reaming. Jesse moans as he power-fucks her asshole, posing her gaping rectum at several points throughout. Her needy cunt continues spraying long-distance fountains of girl squirt as Jax sodomizes her. She gives raunchy, ass-to-mouth head. The rude session delivers intense rod riding and crude gash slamming. Jax fills Jesse's twat with a hot creampie! He scoops the semen from her used vag and feeds it to her!
RapidgatorK2S

Evil Angel - Ashley Lane - Anal Gaping & Pussy Squirt

File: bau9snaevanashlanzq1tflmfs5.mp4
Size: 1.49 GB
Duration: 34:44
Resolution: 1920x1080
Format: mp4
Description: Ashley Lane is a tall, dirty blonde with a pussy that can squirt long-distance! The leggy vixen wears glamorous lingerie, stripping and playing with herself through a sweltering tease sequence. Ashley drools and licks her fingers, wetting them to lubricate masturbation. The skillful babe shows director Pat Myne her special squirting talent. Orgasmic Ashley spreads her legs, and using no hands, spews a juicy cunt geyser across the entire room! Big stud Milan Ponjevic soon arrives. The hung dude subjects Ashley to throat fucking and then pounds her gash to more gushing climaxes. When Milan laps up her juice and spits it into Ashley's mouth, she swallows her own nectar! Milan follows up by fucking her butthole, slowly inching his humungous hog into her sphincter. The graphic anal session serves up hard-riding sodomy, a slew of liquid orgasms, and a crude, ass-to-mouth blowjob. Ashley's rectum gapes. Milan finishes her off with a cum facial. Sperm splattering her face, Ashley says, 'I'm a good whore!'
RapidgatorK2S

Evil Angel - Adira Allure - Pussy Squirt & Anal Kink

File: nu9hknaevanadiall39gaos7kkj.mp4
Size: 1.50 GB
Duration: 35:27
Resolution: 1920x1080
Format: mp4
Description: Blonde MILF Adira Allure models a sexy green lingerie set, teasing and playing with herself in the opening moments. The short-haired, leggy babe whips out her luscious tits and salivates over her nipples, smiling playfully. She bends over to show her booty, soon revealing the large butt plug packed into her asshole. Adira masturbates to an intense, squirting orgasm, spraying her girl juice all over the camera lens! Hugely hung stud Milan Ponjevic arrives to satisfy the severely horny vixen, cramming his big cock into her cunt straight away. Adira talks dirty while Milan drills her slit. She reciprocates with a raunchy blowjob and a freaky rim job. The action intensifies with lusty anal sex, Adira's gash continuing to gush several long-distance squirt geysers throughout. Hardcore sodomy includes rectal gaping and ass-to-mouth cocksucking. For the climax, Adira laps up Milan's sperm and thanks him.
RapidgatorK2S

Evil Angel - Skylar Snow - Pussy Squirt & Anal Kink

File: xviatnaevanskysno7g5w39773t.mp4
Size: 1.32 GB
Duration: 30:45
Resolution: 1920x1080
Format: mp4
Description: Stacked stunner Skylar Snow teases and strips off her lingerie, looking sensational in a steamy intro tease segment. The busty babe stares lustfully as the camera captures multiple, extended views of her gorgeous face, also giving viewers great angles of her juicy booty and big boobs. On the couch, she fingers her wet pussy, provoking a torrential, slit-squirting orgasm. When the girl juice splatters over the lens, Skylar approaches and lewdly licks it clean! She greets superstar stud Vince Karter with a kiss, and the hung dude power-fucks her already soaked gash. Vince quickly moves on to Skylar's asshole, buttfucking the sweet girl to more long-distance squirt showers! This decadent session serves up rod riding, anal gaping and a slobbering, ass-to-mouth blowjob. Skylar gives Vince's huge dick a slippery titty fuck, prefacing a messy cum facial finale.
RapidgatorK2S

Evil Angel - Sabien Demonia - First Rosebud Ever

File: ojvkwnaevansabdemvvookki1sy.mp4
Size: 1.29 GB
Duration: 27:43
Resolution: 1920x1080
Format: mp4
Description: Exciting, super-voluptuous XXX director-performer Sabien DeMonia takes on three big studs -- Jesus Reyes, Little Maly and Leo Santos -- in a freaky foursome. Maly carries the tattooed, naked brunette lust bucket on his shoulders and drops her onto the bed. The macho musclemen feed hungry Sabien their big cocks. She grinds on top of Leo while giving Maly a blowjob. Curvaceous, irrepressible Sabien takes a double-anal reaming, two pricks up her ass together, and double penetration, with dicks stuffing her box and butthole simultaneously! She enjoys airtight treatment as boners pack all three holes at once! The melee continues... Leo sucks on her massively big tits. Orgasmic Sabien showers him with girl squirt! Jesus delivers rounds of hard asshole drilling, and Sabien treats him to a sloppy titty fuck while she strokes and sucks the other two rods. All three studs splash Sabien's jiggling jugs with semen, and she sucks their poles clean.
RapidgatorK2S

Evil Angel - Priscila Belini - Rough 4-On-1 DP & DAP

File: tzzjvnaevanpribelg8vrvpil7n.mp4
Size: 3.33 GB
Duration: 48:25
Resolution: 1920x1080
Format: mp4
Description: Busty sex freak Priscila Belini wears white lingerie with matching stockings, quickly pulling off her panties to play with her wet pussy. The horny babe shakes her booty for the camera and masturbates, soon welcoming hard studs Brian Ragnastone, Deny Lou, Max Dior, and Michael Fly for a gangbang! The hellacious sex starts quickly as Max, Deny and Brian manhandle Priscila while Michael ruthlessly fucks her throat! The dudes take turns sodomizing the adventurous girl, seriously reaming Priscila's rectum through a graphic anal melee. She rims bungholes and gives nasty, ass-to-mouth blowjobs. And Priscila experiences intense double-anal penetration! The hung, dominant dudes subject her to multiple rounds of rabid, two-dick rectal drilling while spitting, smacking, and choking hot, submissive Priscila! Action features immense sphincter gaping! Finally, the guys slather Priscila's mouth in four juicy loads, and she swallows the hot sperm.
RapidgatorK2S

Evil Angel - Scarlet Chase - Pussy Chastity Anal Only V2

File: uxgcwnaevanscachaw5efqqns2d.mp4
Size: 1.02 GB
Duration: 19:20
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Internet star Scarlet Chase is as kinky as they cum... The breathtaking babe wears latex fetish gear, giving us a step-by-step view as she locks her wet pussy in a chastity device! Scarlet tosses the key and performs a sexy tease, raising the heat. The chastity apparatus keeps Scarlet's cunt locked up, but leaves a carefully placed hole for access to her asshole. She stuffs a butt plug in her rectum to stretch it out, soon welcoming partner Elic Chase into view. Elic sodomizes the sweet girl on the couch, smacking her perfectly shaped booty as he reams her butthole. Scarlet gives a nasty, ass-to-mouth blowjob. She frequently flaunts her gaping bunghole through this hot anal encounter. The decadent affair features throat fucking, intense backdoor rod riding and lewd farting. Elic cums on the stunning girl, splattering her big tits with a hot load of semen. She shows off her creamy reward and gives Elic's dick one final suck.
RapidgatorK2S

Evil Angel - Naomi Ryder - Studentatrix

File: cxftpnaevannaoryd7oyv1jn1oh.mp4
Size: 1.38 GB
Duration: 35:41
Resolution: 1920x1080
Format: mp4
Description: Blonde bombshell Naomi is failing Mr. King's class, but that shouldn't be a problem for her because she's hot. Hot girls ALWAYS get A's, but especially since she knows about Mr. King's little secret--that he's a pathetic, ass-worshipping regular who spends hundreds in the VIP room at the strip club where she dances. In this intense facesitting scene, Naomi corners the nervous professor after class, locks the lecture hall door, and quickly turns the tables by reminding him how much time he spends at the strip club sniffing girls' assholes! She orders the married Mr. King to his knees, making him desperately lick and worship her ass, feet, and pussy while she grinds on his face, verbally humiliating him the entire time until he's a broken, obedient mess willing to change every failing grade to an A in exchange for more of her superior body.
RapidgatorK2S

Evil Angel - Vanna Bardot - Anal & Cum Facial POV

File: ctam6naevanvanbardwowajsuuu.mp4
Size: 1.32 GB
Duration: 30:44
Resolution: 1920x1080
Format: mp4
Description: Sexy XXX star Vanna Bardot teases in lingerie, stripping and posing to warm up for a raunchy anal session with director-performer Jonni Darkko. The young brunette bends over to show us her tight asshole, spanking her supple butt cheeks. Vanna goes upstairs to greet Jonni with a messy blowjob. Slobber oozes from her pink lips as she sucks cock. Graphic throat drilling leads to intense buttfucking, and Jonni's intimate POV cam puts viewers practically in the scene. Vanna talks dirty while Jonni slams her stretched sphincter. She pries apart her rear cheeks and poses whenever Jonni pulls his boner out of her butthole. Heated sodomy climaxes with a graphic cum facial. Vanna closes her eyes with the head of Jonni's dick millimeters from her forehead, and she opens her mouth widely as his sperm seeps down her beautiful face. For an epic finale, Jonni offers a recap, showing multiple angles of the cum facial.
RapidgatorK2S

Evil Angel - Stella Luxx - Anal Gaping & A2m Bj POV

File: av5p2naevansteluxzrjkpnmzdb.mp4
Size: 1.14 GB
Duration: 26:40
Resolution: 1920x1080
Format: mp4
Description: Young redhead Stella Luxx wears see-through lingerie in a hot intro, teasing and showing off her hot body. Stella completes her stellar look with fishnets and high-heeled boots, shaking her lusciously plump rump while playfully flirting with the camera. The pretty porn performer lies spread-eagle, cramming a black dildo into her colon! Stella talks dirty while proudly posing her gaping rectum, eager for director-performer Jonni Darkko's stiff dick. She chokes while giving him a blowjob, drooling crudely as Jonni fucks her throat. Next, Jonni stuffs his prick into her sphincter, Stella coaching him as he slithers his shaft deep inside. His graphic, POV-style camera work put rude anal reaming and a sloppy, ass-to-mouth blowjob practically in the viewer's face! Jonni finishes Stella off with a messy cum facial. He uses his still-swollen rod to scoop excess spunk into Stella's mouth, and the sweet girl smiles as the sperm drips down her cheeks.
RapidgatorK2S

Evil Angel - Ivy Ireland - Buttfucking & Gaping POV

File: igqennaevanivyireu4ifsfb4rb.mp4
Size: 1.44 GB
Duration: 33:32
Resolution: 1920x1080
Format: mp4
Description: Top porn star Ivy Ireland rocks sexy, see-through lingerie with matching fishnets and heels. The athletic vixen shakes and shows off to gear up for lewd sodomy with director-performer Jonni Darkko, whose intimate, POV-style shooting captures the action. Ivy spreads her legs on a chair and jams a gigantic black dildo into her asshole, with Jonni offering a helping hand when needed. Her rectum quickly tightens when she pulls the huge toy out. Ivy tastes her anal flavor, sucking the toy ass-to-mouth. Jonni soon stuffs his shaft inside her butthole, pounding Ivy's booty while she talks dirty. The intense backdoor session serves up rectal gaping and a slobbering blowjob, plus multiple, up-close, very personal views of Ivy's luscious butthole. In the finale, Ivy drops to her knees for a nasty cum facial. Jonni drains his balls, and his splooge creams Ivy's gorgeous face as she smiles with satisfaction.
RapidgatorK2S

Evil Angel - Kitty Li - 4-On-1 Rough DP, DVP & DAP

File: 1nv36naevankitlihuagytrsd5.mp4
Size: 3.36 GB
Duration: 50:31
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Kitty Li wears a tiny pink top with tight black leggings. She strips and masturbates to start, prying apart her chunky butt cheeks to flaunt her open sphincter. Director Angelo Godshack storms onto set with hung studs Brian Ragnastone, John Price and Michael Fly. Orgasmic Kitty rides Angelo's throbbing rod her pussy repeatedly ejaculates girl squirt as he ruthlessly sodomizes her! The dudes choke and slap Kitty through an anal gangbang, using every one of her orifices. Kitty gives rim jobs and sloppy, ass-to-mouth blowjobs, choking and wailing through this sordid action. The guys subject her to serious double penetration pounding intense, double-anal reaming and athletic, double-vaginal stuffing! The irrepressible vixen enjoys a melee of rough sex and multiple, twat-gushing orgasms. This epic encounter delivers wide rectal gaping and a creamy climax On her knees, sweet, disheveled Kitty smiles and opens her mouth as all four guys jack off over her. Once she gets the semen collected in her mouth, she swallows it down!
RapidgatorK2S

Evil Angel - Aviana Violet - Anal Gaping & A2m POV

File: xjwycnaevanaviviowcfqx8ysh8.mp4
Size: 1.62 GB
Duration: 34:41
Resolution: 1920x1080
Format: mp4
Description: Aviana Violet's massive tits spill from her tight bra as the bodacious babe performs a heated opening tease. The steamy intro features Aviana in glamorous black lingerie with matching stripper heels, licking her luscious, glossy lips and looking into the POV camera. She spreads her legs, giving viewers a glimpse of her juicy asshole. Director-performer Jonni Darkko assists her, cramming a large dildo into Aviana's anus to prepare her for his stiff prick. She talks dirty when he pumps his pole inside of her, whimpering through an intense anal railing. The freaky bout delivers sloppy deepthroat head lewd rectal gaping and a messy, ass-to-mouth blowjob. Climaxing a nasty, face fuck, Jonni decorates Aviana with a gooey cum facial. The sweet girl smiles and lewdly drools as sperm runs from her forehead, down her cheeks to her mouth. Jonni's slow-motion, split-screen photography details the graphic cum shot.
RapidgatorK2S

Evil Angel - Amirah Adara - Squirt, DP & Creampies

File: kycyonaevanamiadaovno7xwrg5.mp4
Size: 3.58 GB
Duration: 50:16
Resolution: 1920x1080
Format: mp4
Description: Wearing pink jean shorts and a casual top, pretty porn star Amirah Adara caresses her tight, athletic body. The brunette temptress strips and teases, anticipating a rough sex gangbang! Amirah poses her thick booty for the camera, prying apart her plump cheeks to reveal the stretched-open sphincter beneath her panties. Dominant studs Deny Lou, Max Dior and Michael Fly storm onto the scene, immediately sodomizing Amirah! She smiles and moans as Max jackhammers her rectum, proudly posing her gaping anus multiple times.

Things get hectic As Deny drills her asshole, Max chokes and smacks her while she rims Michael! The spit-wet anal foursome includes raunchy, ass-to-mouth blowjobs, serious throat fucking and hard double penetration pounding! Orgasmic Amirah's twat ejaculates blasts of girl squirt! Finally, the guys fill her gash with creampies! Amirah scoops up the cum oozing from her satisfied cunt and tastes it on her fingers.
RapidgatorK2S

Evil Angel - Sabien Demonia - First DAP

File: zu2vhnaevansabdemmb3r9cfdcx.mp4
Size: 1.41 GB
Duration: 32:47
Resolution: 1920x1080
Format: mp4
Description: Extremely voluptuous XXX director-star Sabien DeMonia flaunts her thrillingly curvaceous body encased in a tight, shiny red fetish dress. She bends over to show off her huge, naked ass. Sabien summons studs Jesus Reyes and Little Maly. Her big tits flop from her top. Maly lifts the bodacious, tattooed babe bodily. Sabien squats to suck their hard dicks. Foot fetish The guys peel off her pumps and rub their pricks on her bare soles. Next, Jesus fucks Sabien's pussy. She takes a hard anal slamming from Maly. Orgasmic Sabien unleashes a flood of girl squirt! She gives Maly an ass-to-mouth blowjob, and then he drills her bunghole some more. The decadent threesome intensifies as Sabien enjoys double penetration! More squirting and DP lead to Sabien's very first double-anal reaming -- she packs both pricks in her rectum at once! Maly's cum splashes her open mouth. She takes Jesus' meat in her sloppy cleavage for a titty fuck. His cream explodes into her mouth, and Sabien drools the spunk over her thrill ride body.
RapidgatorK2S

Evil Angel - Jennifer White - Dick-Dildo DAP POV

File: 5nysynaevanjenwhis9ay7vyyxj.mp4
Size: 1.75 GB
Duration: 33:49
Resolution: 1920x1080
Format: mp4
Description: Award-winning XXX superstar Jennifer White poses in skimpy lingerie, whipping out her big tits in a steamy tease sequence. Jennifer shakes her round booty and shows herself off before teaming up with director-performer Jonni Darkko for raunchy anal sex shot POV-style. She warms up her sphincter with a huge black dildo. Jonni slides his shaft up Jennifer's ass as his camera gives us an intimate view, practically putting the audience into the action. Jennifer pries open her butthole several times, holding onto her juicy cheeks while we get a close-up view of her gaping rectum. Things ramp up with dick-dildo double penetration and DAP drilling! The decadent affair wraps up with a sloppy, ass-to-mouth blowjob and a slobber-soaked titty fuck. Jonni rewards the beautiful babe with a massive cum facial, sperm dripping down her forehead and cheeks as she gives him a few final sucks.
RapidgatorK2S

Evil Angel - Megan Love - Rough DP, DAP & Creampies

File: uonqpnaevanmeglovqsmkkkrifw.mp4
Size: 3.20 GB
Duration: 51:36
Resolution: 1920x1080
Format: mp4
Description: Megan Love is a frisky doll that loves rough sex! Starting in lingerie with knee-high socks, the young vixen strips and masturbates. She looks into the camera to say, 'I want to get punished! Hardcore studs Deny Lou, Mark Dozer, Max Dior and Michael Fly have what she needs. One guy sodomizes her while the others slap her and fuck her throat. The dudes use her holes fiercely. Indestructible Megan salivates while giving a graphic, ass-to-mouth blowjob. She keeps encouraging the studs as they manhandle her aggressively. Megan rims bunghole and rides dick through an epic anal gangbang, posing her gaping rectum when it isn't stuffed with big cock. The nastiness ramps up with hard double penetration and intense, double-anal reaming! Megan smiles proudly as the men smack, choke and spit on her. They pump gooey creampies into her cunt. As semen seeps from her slit and over her sphincter, Megan smirks and flips off viewers. Exclusively on EvilAngel.com, the scene includes fisting content -- Deny fists Megan's twat while Max shoves his foot in her mouth!
RapidgatorK2S

Evil Angel - Stephanie Love - Anal Gaping & Squirt

File: ctkzznaevanstelovchlpxdf6f3.mp4
Size: 1.83 GB
Duration: 35:50
Resolution: 1920x1080
Format: mp4
Description: Bodacious blonde Stephanie Love is serious about her job as a social media consultant for director Vince Karter. But the busty, tattooed vixen finds herself overcome with lust, leading to a heated fantasy about Vince... In fetish-style lingerie, she makes out with the hung stud. Stephanie kneels to worship his big cock with a slobbering blowjob. Vince rudely drills her sweet mouth. He warms up her asshole with a rim job and then stuffs his pole into her wet cunt. Stephanie's gigantic booty bounces as Vince power-plows her pussy. He chokes the thick chick during a rough, manhandling anal fuck. Rabid buttfucking leaves orgasmic Stephanie ejaculating multiple blasts of girl squirt! She offers messy, ass-to-mouth cocksucking. Vince pries apart her massive rear cheeks to show off her gaping anus in the process, he blows a premature load over her plump rump! Vince forges on, satisfying Stephanie with dick-dildo double penetration. She treats him to a rim job and a slick titty fuck. He paints her with a cum facial.
RapidgatorK2S

Evil Angel - Nicole Nichols - Anal Gaping & A2m Bj

File: aevgmnaevannicnicgdkfhtptwp.mp4
Size: 2.18 GB
Duration: 33:00
Resolution: 1920x1080
Format: mp4
Description: Slender, flashy platinum blonde Nicole Nichols teases in a delicate, black lace corset with panties and matching, sexy pumps. She doffs her top, revealing tiny, natural breasts she pulls her panties down and shakes her delectable ass. Young Nicole sucks on a rainbow-colored dildo and then slides the wet toy up her sphincter to loosen it. Co-director performer Mark Wood fucks her pussy doggie-style. She gives him a frantic blowjob. Nicole gets back on all fours and takes an anal reaming. She sucks his thick boner ass-to-mouth, with gusto! Nicole takes a bouncing backdoor ride on Mark's meat. He pounds her rectum more, in multiple positions. Nicole's asshole gapes!She gives Mark more skillful oral service, pushing him over the brink. He blasts her with a cum facial, splooge splashing her tongue and dripping from her chin. Pretty Nicole swallows some of the mess.
RapidgatorK2S

Evil Angel - Priscila Belini - DVP, DAP, TVP & TAP

File: cbuqnnaevanpribel9bevzeofwb.mp4
Size: 4.01 GB
Duration: 56:57
Resolution: 1920x1080
Format: mp4
Description: With her tiny, pink top pulled down to reveal her tits, horny vixen Priscila Belini masturbates on the couch, moaning as her wet cunt sloshes loudly. The long-legged girl's fishnets match her lingerie. Without a moment's notice, studs Michael Fly, Neeo, Brian Ragnastone and Mark Dozer storm onto the scene, ready to serve up the rough sex she loves. The men immediately sodomize Priscila! They take turns slam-fucking her sphincter and drilling her pussy while smacking her. This intense gangbang delivers serious, ass-to-mouth throat fucking immense rectal gaping and double-vaginal penetration! Priscila lewdly rims bungholes. Things really ramp up when Neeo and Michael subject Priscila to double-anal reaming. Big cocks fill her rectum, and the vixen indulges in even nastier fun -- next up is triple-vaginal jamming, followed by a wild triple-anal cramming! Each of the guys crudely rewards Priscila with a load of semen.
RapidgatorK2S

Evil Angel - Jadilica - Anal 3-Way With 2 Clinicians

File: sunzbnaevanjadisa8r2o9kvb.mp4
Size: 1.67 GB
Duration: 50:05
Resolution: 1920x1080
Format: mp4
Description: On the grounds of Rocco Siffredi's luxurious sex clinic, staffers Lorenzo Viota and Francis X discuss the mounting stress of their jobs. Indoors, Lorenzo argues with his girlfriend, bespectacled brunette Jadilica. That leads to passionate kissing as they peel off their lab coats. While Jadilica gives him a blowjob, Francis watches them, masturbating. Jadilica takes Francis' prick in her mouth, and a threesome is underway! Lorenzo gives his girlfriend a rim job. He smashes her pussy while she sucks Francis' meat. Francis nails her twat. The flexible doll squats down on Lorenzo's bone for an anal reaming! Next, Francis takes a turn porking hot Jadilca's asshole. She tastes her flavor via ass-to-mouth cocksucking! The men trade her mouth and butthole in several positions. Francis showers Jadilca's pretty, open mouth with spunk. Lorenzo cums next, spunking on her rear.
RapidgatorK2S

Evil Angel - Simone Steele - 5-On-1 DP & DAP Gangbang

File: zsfupnaevansimstexbr38dognc.mp4
Size: 2.14 GB
Duration: 43:00
Resolution: 1920x1080
Format: mp4
Description: Not even star director-performer Richard Mann can keep Simone Steele satisfied all by himself. So, he calls in his crew to assist him with the hot, insatiable sex goddess! Chocolate God, DP Cooper, Musa Phoenix, Goldey and Richard surround kneeling Simone in the early moments, and she provides sloppy circle suck action. Hardcore sodomy comes next, with the men taking turns. They hammer Simone's sphincter to anal gaping and graphic prolapse! The intense gangbang ramps up with serious, double penetration drilling and freaky, double-anal reaming! Tattooed Simone shouts crudely as big Black cocks power-fuck her holes. The melee delivers messy, ass-to-mouth blowjobs, and orgasmic Simone ejaculates multiple gushers of girl squirt! Finally, the nasty girl drops to her knees for five cum facials. She licks balls while the guys jerk off over her, smiling as each load slathers her face!
RapidgatorK2S

Evil Angel - Lola Valentine - Anal Fuck & Cum Facial

File: awxbknaevanlolvaleyxqrmz9h1.mp4
Size: 1.85 GB
Duration: 38:42
Resolution: 1920x1080
Format: mp4
Description: Raven-haired tart Lola Valentine sways through a slow tease in a skimpy black top and sheer, lacy mini skirt. She strips, showing off her bite-size breasts and furry bush. Lolatwerks, flaunting her juicy butt. She fucks her asshole with a glass dildo. The young lady devours co-directorperformer Mark Wood's big cock in an expert blowjob. Mark puts the cutie on all fours and pumps her bunghole. She applies a buzzing vibrator to her twat during the anal pounding. Lola rides, bounces on and enjoys his schlong as Mark sodomizes her repeatedly, in multiple positions. The raunchy session builds to a climax Lola slides off the bed and kneels, opening her mouth widely and extending her tongue. Mark strokes his curved dong until he slathers her with a cum facial, jism overflowing from her mouth and running down her chin. 'Thank you for fucking my ass,' says the satisfied minx.
RapidgatorK2S

Evil Angel - Vittoria Divine - 4on1 DP DVP DAP Squirt

File: 9p3hbnaevanvitdivxecbdpkafc.mp4
Size: 3.37 GB
Duration: 51:30
Resolution: 1920x1080
Format: mp4
Description: Auburn-haired, bespectacled Little Chloe teases, lifting her T-shirt to display her pert titties and flaunting her butt. She pulls aside her white panties to masturbate, leading to a rough sex gangbang! A quintet of beefy studs -- Michael Fly, Neeo, Brian Ragnastone, Deny Lou and Liam Salvatore -- surround Little Chloe as if in a rugby scrum. She gives sloppy blowjobs as the men stuff cocks in her mouth. Michael chokes the petite doll while a boner packs her pussy. Little Chloe gives a rim job, and she receives an anal pounding! Guys spread her limbs widely, and hard dicks ravage all her orifices. Little Chloe takes two pricks in her cunt together, a double-vaginal drilling! The studs slam-bang the bold babe's snatch to gaping. Chloe enjoys rhythmic double penetration -- simultaneous vaginal and anal reaming! Her asshole gapes. Things get even wilder for flexible Chloe with a triple-vaginal invasion! For the climax, the studs take turns cumming inside her cunt. Chloe smiles as her twat lewdly squeezes out the messy creampie filling.
RapidgatorK2S

Evil Angel - Princess Alice & Eliz Benson - Anal RX

File: 48evinaevanprieliy1uhdimhey.mp4
Size: 1.60 GB
Duration: 52:14
Resolution: 1920x1080
Format: mp4
Description: Wearing lab coats, lovely analysts Eliz Benson and Princess Alice discuss new therapy techniques with fellow clinician Aaron Rock. The procedure begins with the trio transported to an alternate reality! Blonde Eliz and devastating brunette Alice wear sexy undergarments. The two scorching beauties give competitive blowjobs to a muscular stud in a mask and cape! The big Black cock they're sucking turns out to be Aaron's. He worships their asses. Aaron fucks both pussies doggie-style. Eliz masturbates as Aaron takes Alice to orgasm. He slides his BBC up Eliz's asshole. Alice feeds on Aaron's schlong with an ass-to-mouth BJ. She takes an anal boning from behind. Aaron sodomizes both analysts in several lewd positions. The non-stop rectal railing reaches a glorious finale as Aaron pumps a thick cum facial onto Princess Alice's chin. She shares the spunk with lush-lipped Eliz, bringing the wild threesome to a climax.
RapidgatorK2S

Evil Angel - Lilith Grace - Anal & Fetish Photo Shoot

File: mvf1tnaevanlilgrahuqtbmv43r.mp4
Size: 2.00 GB
Duration: 50:20
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde Lilith Grace, a curvy cutie, wears a dress for top director-performer Vince Karter, who shoots still photographs. She pops out her round boobs. The sultry lady stuns in a variety of seductive poses. Lilith changes her outfit, donning diaphanous black lingerie and fuzzy black heels, and the photo shoot resumes. Sexual tension builds between Vince and Lilith... She sucks his big cock, giving skilled blowjob service. Lilith takes a doggie-style pussy fuck. Next, Vince plows her asshole as he jams his fingers in her twat. He sits on Lilith's face for a rim job. During an anal reaming, she guides a mammoth, black phallus into her snatch, achieving dickdildo double penetration! Vince pounds her poon and rails her rectum in multiple positions. Foot fetish Submissive Lilith worships Vince's feet. She masturbates while he plows her backyard. The action climaxes as Vince splashes semen on Lilith, leaving her soaked with a messy cum facial.
RapidgatorK2S

Evil Angel - Cherry Candle - Invasive Sexual Therapy

File: 8qft9naevanchecantckq4h8kt2.mp4
Size: 1.40 GB
Duration: 35:09
Resolution: 1920x1080
Format: mp4
Description: At director Rocco Siffredi's crazy sex clinic, fetching redheaded therapist Cherry Candle describes new treatment innovations to her colleagues. European stud Francis X volunteers for the new study. He and Cherry move to another room for privacy. Aggressive Cherry pounces on Francis. She strips down to her undies and gives him an intense blowjob. He spreads her stocking-clad legs widely to eat her pussy. The lithe doll straddles him for a twat-grinding fuck. Cherry takes a ride on Francis' face, and he gives her a rim job. 'Don't fucking stop!' demands Cherry. Francis bangs her snatch doggie-style, and he pounds her box repeatedly in multiple positions. Her natural titties bounce adorably as he relentlessly slams her shaved clam. The action reaches a messy climax Francis busts a creamy load that covers Cherry's jugs. She cleans off his prick and rubs the sticky juice into her boobs like lotion.
RapidgatorK2S

Evil Angel - Stella Scandic - 4-On-1 Gaping & DP Bash

File: b2hgenaevanstescawvjxcqogql.mp4
Size: 3.44 GB
Duration: 53:52
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde Stella Scandic models a skimpy black dress, looking seductively into the camera. She pulls out her breasts, caresses her body and masturbates, playing with her wet pussy in a brief intro preceding an anal gangbang with Max Dior, Michael Fly, Brian Ragnastone and Mark Dozer. The deviant dudes step in, immediately fucking the fit vixen. Deny stuffs his shaft into her twat while the other studs grope, choke and prod Stella's orifices. She loves rough sex! The men trade off drilling her cunt and butthole, one guy lewdly shoving his ass into her face for a rim job! Throat reaming gives Stella nasty, ass-to-mouth flavor. She poses her gaping rectum at various points in the crude encounter. Action ramps up with serious double penetration pounding, the boys smacking and licking her face as they simultaneously drill her box and bunghole. This freaky bash includes relentless sodomy, hard spanking and five creamy cum shots. Stella scoops up all the sperm and swallows it down!
RapidgatorK2S

Evil Angel - Scarlett Rosewood - Gaping & A2m Brat

File: 29gdxnaevanscaroslivqy4utks.mp4
Size: 2.56 GB
Duration: 39:55
Resolution: 1920x1080
Format: mp4
Description: Young, raven-haired hottie Scarlett Rosewood wears pink lingerie, teasing playfully through a sexy intro. The tattooed babe strips and shakes her plump booty for the camera, eager for an intense buttfuck from co-directorperformer Mark Wood. Scarlett lies spread-eagle on the couch, talking dirty while she stretches her rectum with a large toy. The sweet girl greets Mark with a wet blowjob, choking on his big cock through a throat fuck. Crude, spit-soaked head leads to serious cunt fucking. With Scarlett bent over, Mark has his way with her, slam-fucking her slit and spanking her booty. Scarlett's perky tits bounce as Mark nails her. She soon spreads her sphincter for his diamond-hard rod. Anal reaming and riding come with rectal gaping and raunchy, ass-to-mouth fellatio. In the final moments, Mark gives thanks with a hot load of semen, jacking off into Scarlett's open mouth. She smiles as his sperm coats her pink lips, happily professing, 'Tastes so good!'
RapidgatorK2S

Evil Angel - Satine Summers - Rough Reaming & Gaping

File: ubgqgnaevansatsummb6a15wqwu.mp4
Size: 1.64 GB
Duration: 38:22
Resolution: 1920x1080
Format: mp4
Description: Young porn model Satine Summers strips off her sheer lingerie in a steamy tease sequence. The curly-haired cutie fondles her sweet twat and flaunts her round booty before joining co-directorperformer Mark Wood for a heated backdoor fuck. After the intro, Satine sits naked on the bed, stimulating herself with two toys. She shoves a dildo up her ass while buzzing a vibrator on her gash, whimpering through intense masturbation. Mark takes over, pounding Satine's wet slit while choking her. During a blowjob, he subjects the petite babe to serious throat fucking. Next comes hardcore sodomy. Satine continues fondling her box through a rough anal reaming, taking short breaks to give lewd, ass-to-mouth fellatio. The heated affair delivers rectal gaping and rude rod riding. Mark finishes her off with a hot load of cum. Satine swallows creamy semen.
RapidgatorK2S

Evil Angel - Katrina Moreno & Mary Bambola - 3-Way Therapy

File: rhldhnaevankatmarohwn1z3w4x.mp4
Size: 2.37 GB
Duration: 55:52
Resolution: 1920x1080
Format: mp4
Description: Clad in tight white tops and shorts, stylish brunettes Katrina Moreno and Bambola meet therapist Vince Karter on the grounds of Rocco Siffredi's opulent sex clinic. Inside the facility, Katrina confesses that she can only get off with a dildo. In the ensuing, therapeutic threesome, they trade lustful kisses. The ladies enjoy lesbian fun -- Katrina greedily sucks on Bambola's big tits, and Bambola buries her face between Katrina's boobs. The girls suck Vince's big cock, and Bambola rims him. Vince slides his meat into Bambola's bare twat and fucks it. Katrina laps Bambola's clit while Vince pounds Bambola's box. Katrina gives Vince a titty fuck. He jams Katrina's gash. The girls ride Vince like a teeter totter. Finger-banging makes orgasmic Katrina ejaculate girl squirt. Vince drills both horny snatches in several positions. The torrid fun climaxes with Vince splooging on Katrina's rear cheeks. Bambola provides a blowjob clean-off and shares sloppy smooches with Katrina.
RapidgatorK2S

Evil Angel - Richelle Ryan - Obedient Landlord

File: rvzmtnaevanricryav5dyljcwsk.mp4
Size: 1.99 GB
Duration: 47:01
Resolution: 1920x1080
Format: mp4
Description: Richelle Ryan is 4 months behind on her rent but she tells her landlord 'I don't pay rent... I get losers like you to pay rent for me!'. And when you see her HUGE ASS, you'll know why! Jack Vegas would much rather be on his knees licking her asshole than doing his job. He's going to be a good bitch for her! ASS WORSHIP, FOOT WORSHIP, FACESITTING, AND MORE!
RapidgatorK2S