pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
3

Evil Angel - Megan Love - Rough DP, DAP & Creampies

File: uonqpnaevanmeglovqsmkkkrifw.mp4
Size: 3.20 GB
Duration: 51:36
Resolution: 1920x1080
Format: mp4
Description: Megan Love is a frisky doll that loves rough sex! Starting in lingerie with knee-high socks, the young vixen strips and masturbates. She looks into the camera to say, 'I want to get punished! Hardcore studs Deny Lou, Mark Dozer, Max Dior and Michael Fly have what she needs. One guy sodomizes her while the others slap her and fuck her throat. The dudes use her holes fiercely. Indestructible Megan salivates while giving a graphic, ass-to-mouth blowjob. She keeps encouraging the studs as they manhandle her aggressively. Megan rims bunghole and rides dick through an epic anal gangbang, posing her gaping rectum when it isn't stuffed with big cock. The nastiness ramps up with hard double penetration and intense, double-anal reaming! Megan smiles proudly as the men smack, choke and spit on her. They pump gooey creampies into her cunt. As semen seeps from her slit and over her sphincter, Megan smirks and flips off viewers. Exclusively on EvilAngel.com, the scene includes fisting content -- Deny fists Megan's twat while Max shoves his foot in her mouth!
RapidgatorK2S

Evil Angel - Stephanie Love - Anal Gaping & Squirt

File: ctkzznaevanstelovchlpxdf6f3.mp4
Size: 1.83 GB
Duration: 35:50
Resolution: 1920x1080
Format: mp4
Description: Bodacious blonde Stephanie Love is serious about her job as a social media consultant for director Vince Karter. But the busty, tattooed vixen finds herself overcome with lust, leading to a heated fantasy about Vince... In fetish-style lingerie, she makes out with the hung stud. Stephanie kneels to worship his big cock with a slobbering blowjob. Vince rudely drills her sweet mouth. He warms up her asshole with a rim job and then stuffs his pole into her wet cunt. Stephanie's gigantic booty bounces as Vince power-plows her pussy. He chokes the thick chick during a rough, manhandling anal fuck. Rabid buttfucking leaves orgasmic Stephanie ejaculating multiple blasts of girl squirt! She offers messy, ass-to-mouth cocksucking. Vince pries apart her massive rear cheeks to show off her gaping anus in the process, he blows a premature load over her plump rump! Vince forges on, satisfying Stephanie with dick-dildo double penetration. She treats him to a rim job and a slick titty fuck. He paints her with a cum facial.
RapidgatorK2S

Evil Angel - Nicole Nichols - Anal Gaping & A2m Bj

File: aevgmnaevannicnicgdkfhtptwp.mp4
Size: 2.18 GB
Duration: 33:00
Resolution: 1920x1080
Format: mp4
Description: Slender, flashy platinum blonde Nicole Nichols teases in a delicate, black lace corset with panties and matching, sexy pumps. She doffs her top, revealing tiny, natural breasts she pulls her panties down and shakes her delectable ass. Young Nicole sucks on a rainbow-colored dildo and then slides the wet toy up her sphincter to loosen it. Co-director performer Mark Wood fucks her pussy doggie-style. She gives him a frantic blowjob. Nicole gets back on all fours and takes an anal reaming. She sucks his thick boner ass-to-mouth, with gusto! Nicole takes a bouncing backdoor ride on Mark's meat. He pounds her rectum more, in multiple positions. Nicole's asshole gapes!She gives Mark more skillful oral service, pushing him over the brink. He blasts her with a cum facial, splooge splashing her tongue and dripping from her chin. Pretty Nicole swallows some of the mess.
RapidgatorK2S

Evil Angel - Priscila Belini - DVP, DAP, TVP & TAP

File: cbuqnnaevanpribel9bevzeofwb.mp4
Size: 4.01 GB
Duration: 56:57
Resolution: 1920x1080
Format: mp4
Description: With her tiny, pink top pulled down to reveal her tits, horny vixen Priscila Belini masturbates on the couch, moaning as her wet cunt sloshes loudly. The long-legged girl's fishnets match her lingerie. Without a moment's notice, studs Michael Fly, Neeo, Brian Ragnastone and Mark Dozer storm onto the scene, ready to serve up the rough sex she loves. The men immediately sodomize Priscila! They take turns slam-fucking her sphincter and drilling her pussy while smacking her. This intense gangbang delivers serious, ass-to-mouth throat fucking immense rectal gaping and double-vaginal penetration! Priscila lewdly rims bungholes. Things really ramp up when Neeo and Michael subject Priscila to double-anal reaming. Big cocks fill her rectum, and the vixen indulges in even nastier fun -- next up is triple-vaginal jamming, followed by a wild triple-anal cramming! Each of the guys crudely rewards Priscila with a load of semen.
RapidgatorK2S

Evil Angel - Jadilica - Anal 3-Way With 2 Clinicians

File: sunzbnaevanjadisa8r2o9kvb.mp4
Size: 1.67 GB
Duration: 50:05
Resolution: 1920x1080
Format: mp4
Description: On the grounds of Rocco Siffredi's luxurious sex clinic, staffers Lorenzo Viota and Francis X discuss the mounting stress of their jobs. Indoors, Lorenzo argues with his girlfriend, bespectacled brunette Jadilica. That leads to passionate kissing as they peel off their lab coats. While Jadilica gives him a blowjob, Francis watches them, masturbating. Jadilica takes Francis' prick in her mouth, and a threesome is underway! Lorenzo gives his girlfriend a rim job. He smashes her pussy while she sucks Francis' meat. Francis nails her twat. The flexible doll squats down on Lorenzo's bone for an anal reaming! Next, Francis takes a turn porking hot Jadilca's asshole. She tastes her flavor via ass-to-mouth cocksucking! The men trade her mouth and butthole in several positions. Francis showers Jadilca's pretty, open mouth with spunk. Lorenzo cums next, spunking on her rear.
RapidgatorK2S

Evil Angel - Simone Steele - 5-On-1 DP & DAP Gangbang

File: zsfupnaevansimstexbr38dognc.mp4
Size: 2.14 GB
Duration: 43:00
Resolution: 1920x1080
Format: mp4
Description: Not even star director-performer Richard Mann can keep Simone Steele satisfied all by himself. So, he calls in his crew to assist him with the hot, insatiable sex goddess! Chocolate God, DP Cooper, Musa Phoenix, Goldey and Richard surround kneeling Simone in the early moments, and she provides sloppy circle suck action. Hardcore sodomy comes next, with the men taking turns. They hammer Simone's sphincter to anal gaping and graphic prolapse! The intense gangbang ramps up with serious, double penetration drilling and freaky, double-anal reaming! Tattooed Simone shouts crudely as big Black cocks power-fuck her holes. The melee delivers messy, ass-to-mouth blowjobs, and orgasmic Simone ejaculates multiple gushers of girl squirt! Finally, the nasty girl drops to her knees for five cum facials. She licks balls while the guys jerk off over her, smiling as each load slathers her face!
RapidgatorK2S

Evil Angel - Lola Valentine - Anal Fuck & Cum Facial

File: awxbknaevanlolvaleyxqrmz9h1.mp4
Size: 1.85 GB
Duration: 38:42
Resolution: 1920x1080
Format: mp4
Description: Raven-haired tart Lola Valentine sways through a slow tease in a skimpy black top and sheer, lacy mini skirt. She strips, showing off her bite-size breasts and furry bush. Lolatwerks, flaunting her juicy butt. She fucks her asshole with a glass dildo. The young lady devours co-directorperformer Mark Wood's big cock in an expert blowjob. Mark puts the cutie on all fours and pumps her bunghole. She applies a buzzing vibrator to her twat during the anal pounding. Lola rides, bounces on and enjoys his schlong as Mark sodomizes her repeatedly, in multiple positions. The raunchy session builds to a climax Lola slides off the bed and kneels, opening her mouth widely and extending her tongue. Mark strokes his curved dong until he slathers her with a cum facial, jism overflowing from her mouth and running down her chin. 'Thank you for fucking my ass,' says the satisfied minx.
RapidgatorK2S

Evil Angel - Vittoria Divine - 4on1 DP DVP DAP Squirt

File: 9p3hbnaevanvitdivxecbdpkafc.mp4
Size: 3.37 GB
Duration: 51:30
Resolution: 1920x1080
Format: mp4
Description: Auburn-haired, bespectacled Little Chloe teases, lifting her T-shirt to display her pert titties and flaunting her butt. She pulls aside her white panties to masturbate, leading to a rough sex gangbang! A quintet of beefy studs -- Michael Fly, Neeo, Brian Ragnastone, Deny Lou and Liam Salvatore -- surround Little Chloe as if in a rugby scrum. She gives sloppy blowjobs as the men stuff cocks in her mouth. Michael chokes the petite doll while a boner packs her pussy. Little Chloe gives a rim job, and she receives an anal pounding! Guys spread her limbs widely, and hard dicks ravage all her orifices. Little Chloe takes two pricks in her cunt together, a double-vaginal drilling! The studs slam-bang the bold babe's snatch to gaping. Chloe enjoys rhythmic double penetration -- simultaneous vaginal and anal reaming! Her asshole gapes. Things get even wilder for flexible Chloe with a triple-vaginal invasion! For the climax, the studs take turns cumming inside her cunt. Chloe smiles as her twat lewdly squeezes out the messy creampie filling.
RapidgatorK2S

Evil Angel - Princess Alice & Eliz Benson - Anal RX

File: 48evinaevanprieliy1uhdimhey.mp4
Size: 1.60 GB
Duration: 52:14
Resolution: 1920x1080
Format: mp4
Description: Wearing lab coats, lovely analysts Eliz Benson and Princess Alice discuss new therapy techniques with fellow clinician Aaron Rock. The procedure begins with the trio transported to an alternate reality! Blonde Eliz and devastating brunette Alice wear sexy undergarments. The two scorching beauties give competitive blowjobs to a muscular stud in a mask and cape! The big Black cock they're sucking turns out to be Aaron's. He worships their asses. Aaron fucks both pussies doggie-style. Eliz masturbates as Aaron takes Alice to orgasm. He slides his BBC up Eliz's asshole. Alice feeds on Aaron's schlong with an ass-to-mouth BJ. She takes an anal boning from behind. Aaron sodomizes both analysts in several lewd positions. The non-stop rectal railing reaches a glorious finale as Aaron pumps a thick cum facial onto Princess Alice's chin. She shares the spunk with lush-lipped Eliz, bringing the wild threesome to a climax.
RapidgatorK2S

Evil Angel - Lilith Grace - Anal & Fetish Photo Shoot

File: mvf1tnaevanlilgrahuqtbmv43r.mp4
Size: 2.00 GB
Duration: 50:20
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde Lilith Grace, a curvy cutie, wears a dress for top director-performer Vince Karter, who shoots still photographs. She pops out her round boobs. The sultry lady stuns in a variety of seductive poses. Lilith changes her outfit, donning diaphanous black lingerie and fuzzy black heels, and the photo shoot resumes. Sexual tension builds between Vince and Lilith... She sucks his big cock, giving skilled blowjob service. Lilith takes a doggie-style pussy fuck. Next, Vince plows her asshole as he jams his fingers in her twat. He sits on Lilith's face for a rim job. During an anal reaming, she guides a mammoth, black phallus into her snatch, achieving dickdildo double penetration! Vince pounds her poon and rails her rectum in multiple positions. Foot fetish Submissive Lilith worships Vince's feet. She masturbates while he plows her backyard. The action climaxes as Vince splashes semen on Lilith, leaving her soaked with a messy cum facial.
RapidgatorK2S

Evil Angel - Cherry Candle - Invasive Sexual Therapy

File: 8qft9naevanchecantckq4h8kt2.mp4
Size: 1.40 GB
Duration: 35:09
Resolution: 1920x1080
Format: mp4
Description: At director Rocco Siffredi's crazy sex clinic, fetching redheaded therapist Cherry Candle describes new treatment innovations to her colleagues. European stud Francis X volunteers for the new study. He and Cherry move to another room for privacy. Aggressive Cherry pounces on Francis. She strips down to her undies and gives him an intense blowjob. He spreads her stocking-clad legs widely to eat her pussy. The lithe doll straddles him for a twat-grinding fuck. Cherry takes a ride on Francis' face, and he gives her a rim job. 'Don't fucking stop!' demands Cherry. Francis bangs her snatch doggie-style, and he pounds her box repeatedly in multiple positions. Her natural titties bounce adorably as he relentlessly slams her shaved clam. The action reaches a messy climax Francis busts a creamy load that covers Cherry's jugs. She cleans off his prick and rubs the sticky juice into her boobs like lotion.
RapidgatorK2S

Evil Angel - Stella Scandic - 4-On-1 Gaping & DP Bash

File: b2hgenaevanstescawvjxcqogql.mp4
Size: 3.44 GB
Duration: 53:52
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde Stella Scandic models a skimpy black dress, looking seductively into the camera. She pulls out her breasts, caresses her body and masturbates, playing with her wet pussy in a brief intro preceding an anal gangbang with Max Dior, Michael Fly, Brian Ragnastone and Mark Dozer. The deviant dudes step in, immediately fucking the fit vixen. Deny stuffs his shaft into her twat while the other studs grope, choke and prod Stella's orifices. She loves rough sex! The men trade off drilling her cunt and butthole, one guy lewdly shoving his ass into her face for a rim job! Throat reaming gives Stella nasty, ass-to-mouth flavor. She poses her gaping rectum at various points in the crude encounter. Action ramps up with serious double penetration pounding, the boys smacking and licking her face as they simultaneously drill her box and bunghole. This freaky bash includes relentless sodomy, hard spanking and five creamy cum shots. Stella scoops up all the sperm and swallows it down!
RapidgatorK2S

Evil Angel - Scarlett Rosewood - Gaping & A2m Brat

File: 29gdxnaevanscaroslivqy4utks.mp4
Size: 2.56 GB
Duration: 39:55
Resolution: 1920x1080
Format: mp4
Description: Young, raven-haired hottie Scarlett Rosewood wears pink lingerie, teasing playfully through a sexy intro. The tattooed babe strips and shakes her plump booty for the camera, eager for an intense buttfuck from co-directorperformer Mark Wood. Scarlett lies spread-eagle on the couch, talking dirty while she stretches her rectum with a large toy. The sweet girl greets Mark with a wet blowjob, choking on his big cock through a throat fuck. Crude, spit-soaked head leads to serious cunt fucking. With Scarlett bent over, Mark has his way with her, slam-fucking her slit and spanking her booty. Scarlett's perky tits bounce as Mark nails her. She soon spreads her sphincter for his diamond-hard rod. Anal reaming and riding come with rectal gaping and raunchy, ass-to-mouth fellatio. In the final moments, Mark gives thanks with a hot load of semen, jacking off into Scarlett's open mouth. She smiles as his sperm coats her pink lips, happily professing, 'Tastes so good!'
RapidgatorK2S

Evil Angel - Satine Summers - Rough Reaming & Gaping

File: ubgqgnaevansatsummb6a15wqwu.mp4
Size: 1.64 GB
Duration: 38:22
Resolution: 1920x1080
Format: mp4
Description: Young porn model Satine Summers strips off her sheer lingerie in a steamy tease sequence. The curly-haired cutie fondles her sweet twat and flaunts her round booty before joining co-directorperformer Mark Wood for a heated backdoor fuck. After the intro, Satine sits naked on the bed, stimulating herself with two toys. She shoves a dildo up her ass while buzzing a vibrator on her gash, whimpering through intense masturbation. Mark takes over, pounding Satine's wet slit while choking her. During a blowjob, he subjects the petite babe to serious throat fucking. Next comes hardcore sodomy. Satine continues fondling her box through a rough anal reaming, taking short breaks to give lewd, ass-to-mouth fellatio. The heated affair delivers rectal gaping and rude rod riding. Mark finishes her off with a hot load of cum. Satine swallows creamy semen.
RapidgatorK2S

Evil Angel - Katrina Moreno & Mary Bambola - 3-Way Therapy

File: rhldhnaevankatmarohwn1z3w4x.mp4
Size: 2.37 GB
Duration: 55:52
Resolution: 1920x1080
Format: mp4
Description: Clad in tight white tops and shorts, stylish brunettes Katrina Moreno and Bambola meet therapist Vince Karter on the grounds of Rocco Siffredi's opulent sex clinic. Inside the facility, Katrina confesses that she can only get off with a dildo. In the ensuing, therapeutic threesome, they trade lustful kisses. The ladies enjoy lesbian fun -- Katrina greedily sucks on Bambola's big tits, and Bambola buries her face between Katrina's boobs. The girls suck Vince's big cock, and Bambola rims him. Vince slides his meat into Bambola's bare twat and fucks it. Katrina laps Bambola's clit while Vince pounds Bambola's box. Katrina gives Vince a titty fuck. He jams Katrina's gash. The girls ride Vince like a teeter totter. Finger-banging makes orgasmic Katrina ejaculate girl squirt. Vince drills both horny snatches in several positions. The torrid fun climaxes with Vince splooging on Katrina's rear cheeks. Bambola provides a blowjob clean-off and shares sloppy smooches with Katrina.
RapidgatorK2S

Evil Angel - Richelle Ryan - Obedient Landlord

File: rvzmtnaevanricryav5dyljcwsk.mp4
Size: 1.99 GB
Duration: 47:01
Resolution: 1920x1080
Format: mp4
Description: Richelle Ryan is 4 months behind on her rent but she tells her landlord 'I don't pay rent... I get losers like you to pay rent for me!'. And when you see her HUGE ASS, you'll know why! Jack Vegas would much rather be on his knees licking her asshole than doing his job. He's going to be a good bitch for her! ASS WORSHIP, FOOT WORSHIP, FACESITTING, AND MORE!
RapidgatorK2S

Evil Angel - Liv Revamped - Gaping Size Queen Milf

File: olklqnaevanlivrevkrbonmcyi2.mp4
Size: 1.26 GB
Duration: 29:30
Resolution: 1920x1080
Format: mp4
Description: Hot MILF size queen Liv Revamped poses in pink lingerie, shaking her round booty through a sexy tease sequence. The curly-haired vixen shows off and spreads her butt cheeks for the camera, soon joining massively hung Damion Dayski for a decadent backdoor throwdown. Liv grabs hold of Damion's big Black cock, stroking it while talking to viewers about what she's about to do. She chokes when Damion crams his huge erection into her mouth, drooling profusely through a graphic blowjob. Liv hops on his lap, whimpering as Damion slides his gigantic shaft into her sphincter. Hard anal sex comes with sloppy, ass-to-mouth fellatio and lewd rectal gaping. Liv farts when Damion pulls his boner out of her wrecked butthole. The hungry hottie opens her mouth for his hot cum and swallows the droplets of sperm that land on her tongue. Liv thanks Damion for stretching her sweet asshole.
RapidgatorK2S

Evil Angel - Mary Jane - DAP, Airtight & Foot Fetish

File: u2vasnaevanmarjan2jqzthvmfz.mp4
Size: 3.97 GB
Duration: 01:01:00
Resolution: 1920x1080
Format: mp4
Description: Hot redhead Mary Jane wears a tube top with black leggings and chunky heels. She removes her dark panties to masturbate. A trio of muscled studs springs into action -- Mark Dozer, Michael Fly and Angel Godshack immediately shove boners into her mouth and up her asshole. The guys manhandle Mary Jane relentlessly in a symphony of rough sex -- hair pulling, choking, body and face slapping! Anal pounding in various positions stretches Mary Jane's sphincter to gaping. She sucks a pair of pricks ass-to-mouth. The lady enjoys double penetration and airtight reaming! She takes a double-anal cramming! During a doggie-style drilling, the freaky girl indulges her foot fetish with freaky subservience! Mary Jane rims Mark. Angelo rubs her foot on his ball sack while she sucks on his feet. The guys take turns cumming in Mary Jane's mouth, coating her tongue with volleys of jism, and the runoff trickles down her chin.
RapidgatorK2S

Evil Angel - Christy Love - Size Queen Squirts

File: z92danaevanchrlov41kzp4fycy.mp4
Size: 1.10 GB
Duration: 28:56
Resolution: 1920x1080
Format: mp4
Description: Hot MILF Christy Love won't fuck around with small dicks. The dirty-talking size queen isn't shy about it -- Christy says she doesn't only prefer big cock, she requires it! When tall stud Richard Mann stops by to clean Christy's swimming pool, she makes clear that it's not the pool she wants serviced. Wearing stylish lingerie, Christy teases on the bed-top, stripping and posing. She heats Richard up with a worshipful blowjob, salivating as she attempts to cram his gigantic cock down her throat. Christy hops on his lap, slowly sliding Richard's humongous rod into her wet slit. Hardcore intercourse makes her cunt cream, and then orgasmic Christy blasts multiple gushers of girl squirt! She shouts wildly as Richard fucks the living hell out of her! Ms. Love takes short breaks from the madness to blow Richard and talk to the camera. The intense session includes kinky jerk-off encouragement, squirting gash geysers, and a tasty cum shot finale Christy opens her mouth for Richard's hot sperm, and she swallows his load.
RapidgatorK2S

Evil Angel - Scarlett Alexis - Anal Gaping & A2m

File: 1qh79naevanscaalelzqcxjfuzv.mp4
Size: 2.03 GB
Duration: 35:32
Resolution: 1920x1080
Format: mp4
Description: Raven-haired Scarlett Alexis struts in black lingerie, coquettishly winking at the camera while flaunting her fit body. Excited to enjoy super-hung Damion Dayski's big Black cock, the stylish size queen poses and teases before finally meeting up with him. Scarlett crawls to the couch, immediately diving face-first into Damion's crotch. She unsheathes his 12-incher and swiftly stuffs the mahogany meat into her mouth. Warming up for hard sodomy, Scarlett chokes and drools while Damion fucks her tiny throat. She moans as he eases his pole into her rectum. Damion grinds away, slowly stretching her sphincter. Decadent anal action includes intense rod riding, wide backdoor gaping, and a raunchy, ass-to-mouth blowjob. Damion finishes her off with an epic face fuck, ultimately splattering adorable Scarlett with a hot cum facial. Drops of spunk land in her mouth.
RapidgatorK2S

Evil Angel - Little Chloe - DP, DVP, Tvp & Creampies

File: vgiwinaevanlitchljv6f67vsaz.mp4
Size: 3.01 GB
Duration: 49:14
Resolution: 1920x1080
Format: mp4
Description: Auburn-haired, bespectacled Little Chloe teases, lifting her T-shirt to display her pert titties and flaunting her butt. She pulls aside her white panties to masturbate, leading to a rough sex gangbang! A quintet of beefy studs -- Michael Fly, Neeo, Brian Ragnastone, Deny Lou and Liam Salvatore -- surround Little Chloe as if in a rugby scrum. She gives sloppy blowjobs as the men stuff cocks in her mouth. Michael chokes the petite doll while a boner packs her pussy.

Little Chloe gives a rim job, and she receives an anal pounding! Guys spread her limbs widely, and hard dicks ravage all her orifices. Little Chloe takes two pricks in her cunt together, a double-vaginal drilling! The studs slam-bang the bold babe's snatch to gaping. Chloe enjoys rhythmic double penetration -- simultaneous vaginal and anal reaming! Her asshole gapes. Things get even wilder for flexible Chloe with a triple-vaginal invasion! For the climax, the studs take turns cumming inside her cunt. Chloe smiles as her twat lewdly squeezes out the messy creampie filling.
RapidgatorK2S

Evil Angel - Rissa May - Titty Fuck & Anal Gaping

File: flisinaevanrismaydtuhqr5afa.mp4
Size: 1.47 GB
Duration: 30:48
Resolution: 1920x1080
Format: mp4
Description: Busty Rissa May teases in glamorous lingerie. The comely brunette is eager to have her plump booty crammed with big Black cock! She poses and plays through a brief intro, soon joining hung stud Damion Dayski for an intense anal session. Rissa masturbates while Damion vigorously drills her asshole, prying apart her juicy rear cheeks whenever he yanks his massive meat from her rectum. Her big boobs jiggle as she rides BBC, showing off her gaping bunghole multiple times through an epic encounter. Damion slam-fucks the sweet, moaning girl's sphincter till it's thoroughly wrecked. With the top half of his pole buried in her backdoor, Rissa strokes the exposed half of his shaft and fondles his balls. The self-described size queen finishes Damion off with a spit-slick titty fuck, opening her mouth for a cum facial. Hot sperm shoots from Damion's 12-inch dick and oozes down her cheek.
RapidgatorK2S

Evil Angel - Lila Lust - Big-Cock Anal Reaming & A2m

File: jadkgnaevanlillusqnwunhhfdc.mp4
Size: 1.59 GB
Duration: 36:55
Resolution: 1920x1080
Format: mp4
Description: Tasty brunette Lila Lust slow-teases in an ultra-thin, string bikini top and lacy mini-skirt with strappy black heels. She slides her skirt down, leaving only a G-string to cover her poon. Next, Lila joins accomplished XXX director-stud Mick Blue for a quick,pre-scene interview shot POV-style. She removes her panties and spreads her ass cheeks. Mick provides shiny lube for Lila to rub into her skin. She twerks her big ass. He soaks Lila's pussy with more lotion that she masturbates into her snatch. Mick slides a forefinger into her butthole. Then he crams his big cock up her bunghole and porks it! Lila devours his huge, flavorful erection in an ass-to-mouth blowjob. Mick delivers a doggie-style anal drilling. He rails her rectum in several positions. The fun builds to a spunky finale Mick ejaculates onto her tongue, drenching it with semen.
RapidgatorK2S

Evil Angel - Samantha Reigns - Anal, A2m & Rim Job

File: bwlmnnaevansamreigng9qmug3l.mp4
Size: 1.56 GB
Duration: 36:26
Resolution: 1920x1080
Format: mp4
Description: Slim, auburn-haired temptress Samantha Reigns dances a sultry tease in a black bra and mini skirt over a sheer, sparkly body stocking. She exposes her natural tits and smiles as the camera takes in her lovely anatomy. Samantha joins porn director Mick Blue for a brief Q and A. She lifts her skirt and spreads her rear cheeks as Mick's intimate camera captures her tight butthole. Ms. Reigns giggles as she masturbates. Mick applies slippery lube to her gash. He works a finger and then a long dildo into her sphincter, stretching it. Mick's big cock plunges into Samantha's booty. She gorges on his boner in a perverse, ass-to-mouth blowjob. Horny Samantha gives him a rim job. Mick puts her on all fours to plow her posterior. She extends her heels high for more anal drilling, and he sodomizes her in several positions. Mick fucks her cunt, too. The fun cums to a climax as Mick uncorks a fountain of jism, coating Samantha's tongue.
RapidgatorK2S

Evil Angel - Mandii Rose - Anal Fuck, Pussy Creampie

File: rxgdunaevanmanrosvwa9gsq1ai.mp4
Size: 2.59 GB
Duration: 35:08
Resolution: 1920x1080
Format: mp4
Description: Decked out in a jet black outfit with fishnet stockings, streaked-blonde Mandii Rose grooves through a seductive tease. She unveils her natural tits, showing them off as esteemed porn director-performer Mick Blue employs his intimate camera style. Mandii rubs her pussy over the fishnets as Mick pours lube on top. She masturbates, massaging herself with the clear liquid. Mick tears open her stockings to eat her snatch. He fucks Mandii's twat. Next, Mick deploys a huge dildo to stretch Mandii's sphincter. He slides his wet prick into her butthole and pumps away. Mandii takes his tasty tool in her mouth, giving an ass-to-mouth blowjob. Mick delivers a hard, doggie-style anal reaming, and he pounds Mandii's rectum in several positions. She feeds on his meat, enjoying more A2M flavor. Mick goes back to slamming her box, till he pumps a creampie inside. Mandii's cunny squeezes out a thick stream of jism.
RapidgatorK2S

Evil Angel - Ivy Ireland - Ass Gaping, A2m & Facial

File: lb4rznaevanivyireoa8opiihkr.mp4
Size: 1.66 GB
Duration: 27:46
Resolution: 1920x1080
Format: mp4
Description: Porn superstar Ivy Ireland sports a stylish, fetish-inspired look -- a revealing top with black high-heel boots and red fishnet gloves. The gorgeous brunette teases, showing off her long legs and lusciously big tits. Ivy finds herself standing next to Damion Dayski, stroking the superstud's humongous dick while giving viewers play-by-play narration. She kneels, choking and salivating as she worships Damion's big Black cock with a blowjob. Ivy masturbates as Damion snakes his shaft into her sphincter, and she's ecstatic when the fat 12-incher finally fills her rectum. Damion ruthlessly drills her asshole, taking short breaks for furious, ass-to-mouth throat fucking. Intense anal fun includes rod riding, multiple rounds of rectal gaping, and epic dirty talk. Damion rewards the insatiable size queen with a hot cum facial. Ivy plays with the creamy semen as it oozes down her cheeks. She thanks Damion for 'obliterating' her hole.
RapidgatorK2S

Evil Angel - Julia James - Anal, A2m & Rim Job Date

File: bywkknaevanjuljambrfi8ddgdv.mp4
Size: 2.13 GB
Duration: 37:51
Resolution: 1920x1080
Format: mp4
Description: Leggy, auburn-haired ingnue Julia James teases in a rainbow-colored string bikini. The cute waif smiles as she pops out her natural breasts. Top director-performer Mick Blue and Julia exchange playful, pre-scene banter. She uses her slender digits to insert clear lube into her asshole. Mick applies more oil to her hairy pussy. He fingers her butthole while she masturbates. Mick loosens Julia's rectum more with a dildo, and then he fucks her up the ass. Uninhibited Julia gives him an ass-to-mouth blowjob and a rim job. She rides Mick, taking his meat in her pussy. Julia enjoys more anal boning as Mick sodomizes her doggie-style. In a spunky finale, Julia strokes his big cock to ejaculation. Jism runs from her mouth and down her chin. She smiles sweetly, adding, 'Thank you for all the cum.'
RapidgatorK2S

Evil Angel - Angie Lynx - 4-On-1 DP & Creampie Orgy

File: q1ivinaevananglynny8xoertpq.mp4
Size: 3.68 GB
Duration: 54:42
Resolution: 1920x1080
Format: mp4
Description: Mesmerizing blonde vixen Angie Lynx writhes on the bed in sexy lingerie -- bra, corset and sheer stockings. She rubs her twat over her delicate panties. A quartet of studs Brian Ragnastone, Max Dior, Michael Fly and Neeo swarms over the gorgeous babe. She enjoys cunnilingus, and she gives blowjob service, trading stiff dicks in her mouth. Guys fuck Angie's pussy feverishly. They bone her butthole as she strokes more pricks. The dirty girl gives rim jobs. Angie takes a double penetration pounding! She sucks boners ass-to-mouth. It's nonstop anal reaming as the men take turns in her asshole, which gapes! Orgasmic Angie masturbates, conjuring a fountain of girl squirt! She enjoys multiple rounds of DP fulfillment. The four-on-one orgy climaxes as the guys fill Angie's cunt with creampies! She smiles as the semen slowly drains from her fully fucked gash.
RapidgatorK2S

Evil Angel - Sabien Demonia - 0% Pussy 100% Anal Squirt Atm

File: arwbpnaevansabdemfaegecsjbe.mp4
Size: 1.58 GB
Duration: 36:24
Resolution: 1920x1080
Format: mp4
Description: Brazen, curvaceous Sabien DeMonia is excited for a freaky backdoor fuck. The outrageous, tattooed vixen talks about the upcoming scene and models leopard-print lingerie that barely covers her massive jugs. Stud Jesus Reyes steps in next, caressing Sabien's big tits and fingering her pussy. The zaftig beauty exposes his lengthy big Black cock, choking as she gives him a raunchy blowjob. Aggressive, slobber-soaked throat fucking leads to intense sodomy. Sabien's fleshy melons bounce wildly through hard anal reaming, and the hypersexual babe has multiple, squirting orgasms! This rowdy fuck date delivers rectal gaping and nasty, ass-to-mouth fellatio, plus foot fetish! Sabien finishes Jesus off with a slick titty fuck. He sprays a hot load of sperm over her juicy knockers. She gives his prick a few final sucks, surplus semen dripping from her cheeks and oozing over her thick body.
RapidgatorK2S

Evil Angel - Eva Fay - Rough Deepthroat, Anal & A2m

File: oz4kvnaevanevafay3echltd4mk.mp4
Size: 2.76 GB
Duration: 54:13
Resolution: 1920x1080
Format: mp4
Description: Petite, dreadlocked redhead Eva Fay rocks a tiny dress in a cozy bedroom setting. Pervy, dominant director-performer Toby Dick greets her with hard face slaps. She chokes through a deepthroat blowjob. Toby spits in her face and smacks the damsel more. He fucks her mouth as she drools. Eva gives him a rim job. The blue-eyed honey takes an anal railing, doggie style. Eva breathlessly masturbates while Toby pounds her asshole more. He props Eva's ankles up, stuffing her butthole to maximum depth! The nasty fucker sodomizes her in several positions. He feeds Eva his tool straight from her rectum, and she enjoys ass-to-mouth flavor. Eva strokes Toby's boner and sucks on his balls. She extends her tongue as he pumps out a load, leaving Eva with a creamy cum facial and climaxing the rough sex she loves.
RapidgatorK2S

Evil Angel - Baby Kxtten & Indy Lix - Gaping & Squirt

File: uloxqnaevanbabindhdjha8ixu1.mp4
Size: 4.11 GB
Duration: 59:04
Resolution: 1920x1080
Format: mp4
Description: Hot, young tarts Baby Kxtten and Indy Lix love extreme, hardcore fun and rough anal sex. They model white hose and matching dresses, Baby Kxtten in orange and Indy in jet black. The ladies masturbate and share some lesbian make-out play to warm up for a freaky foursome with hung studs Deny Lou and Michael Fly. As the dudes sodomize both girls, Baby Kxtten spits in Indy's face and gropes her skinny body. Deny strips off Baby Kxtten's panties and stuffs them in her mouth while fucking her asshole.

He smacks and chokes the submissive girl through a serious backdoor reaming. This insane session serves up sloppy, ass-to-mouth blowjobs ferocious throat drilling and wide rectal gaping! Orgasmic Baby Kxtten's wet gash squirts girl juice multiple times. Indy and Baby Kxtten rim bungholes and give raunchy head. Finally, Mike and Deny reward each girl, pumping hot loads into their hungry mouths. Baby Kxtten and Indy orally swap semen and swallow.
RapidgatorK2S

Evil Angel - Hazel Heart - Gaping, Deepthroating Teen

File: gubsunaevanhazheafssaffsrsl.mp4
Size: 1.90 GB
Duration: 44:09
Resolution: 1920x1080
Format: mp4
Description: Cute, young starlet Hazel Heart looks adorable in a shiny, tiny blue bikini with clear stripper heels. She teases, eagerly showing her tight body for the camera. The sweet girl slides a finger into her wet pussy, soon crawling to a suction dildo fastened to a mirror. Hazel says she loves sucking cock as she slurps on the toy. She bends over, revealing the butt plug in her sphincter. Hazel sucks the toy ass-to-mouth, tasting her anal flavor. She welcomes Jay Romero with a sloppy blowjob. The hung dude fucks her throat and spanks her booty. Hazel hops on his lap for intense pussy pounding. Jay chokes her as she rides him, soon inching his lengthy pole into her tight sphincter. Hazel crams a toy into her mouth while Jay sodomizes her. She poses her gaping rectum when he yanks his pork from her tight rump. The epic romp includes deepthroat fellatio and kinky foot fetish. Jay coats her groomed bush with semen, Hazel smiling as she tastes the gooey slop.
RapidgatorK2S

Evil Angel - Anissa Kate - Gaping, Titty Fucking Milf

File: jrrv7naevananikatj3sewp1zxy.mp4
Size: 1.65 GB
Duration: 38:26
Resolution: 1920x1080
Format: mp4
Description: Award-winning MILF star Anissa Kate caresses her extra-large breasts, wearing red lingerie with stockings and matching heels. The busty beauty masturbates, playing with her sweet pussy for a warm-up and then sodomizing herself with a glass dildo. Heavily hung stud Vince Karter steps in and unleashes his big cock, amazing Anissa with its massive size. He stuffs it down her throat to give her an idea of what to expect, and they follow up with intense anal reaming. Anissa treats him to a slick titty fuck and gives a messy, ass-to-mouth blowjob. The lewd encounter delivers choking, rowdy anal riding and rectal gaping. Vince's throbbing tool hammers Anissa's butthole while the horny babe begs him to go harder. For the climax, Vince pumps a juicy load into Anissa's open mouth, sperm spraying over her outstretched tongue and oozing down her big boobs.
RapidgatorK2S

Evil Angel - Indica Marie - Anal, Deepthroat & Squirt

File: m4gkpnaevanindmarhzh8rl3blu.mp4
Size: 1.68 GB
Duration: 36:15
Resolution: 1920x1080
Format: mp4
Description: Hot brunette, Indica Marie is known around her office as a computer programming genius. She's so far ahead of her colleagues that her company has called in an expert to keep her focused. There's one problem The tattooed hottie has a major crush on her mentor, Vince Karter. As Vince explains some of his theories on the white board, Indica has a nasty fantasy... Her juicy tits ooze from her fishnet top as Vince fucks her wet pussy from behind, talking dirty. Indica gives a slobbering blowjob, soaking Vince's big cock. Intense fucking makes her pussy cream. Vince slides his huge pole into her sphincter. Nasty anal reaming leads to ass-to-mouth fellatio with impressive deepthroat cocksucking. Indica rides Vince's rod. She ejaculates girl squirt! And she rudely rims him. Indica treats Mr. Karter to a slick titty fuck, leading to a creamy climax. Vince shoots his load, a cum facial with more semen for Indica's chest. Returning to reality in her office, Indica realizes she's been fantasizing.'
RapidgatorK2S

Evil Angel - Rissa May - Busty, Ass Gaping & A2m Teen

File: nphfonaevanrismayuyepthhe2s.mp4
Size: 1.67 GB
Duration: 34:32
Resolution: 1920x1080
Format: mp4
Description: Young starlet Rissa May models a tight blue bikini, posing and shaking her big tits for viewers. The busty vixen strips and spreads her holes through a heated tease sequence, soon lying on the couch to stretch her sphincter for stud Zac Wild. Miss May jams a large toy into her rectum to ensure she's ready for Zac's rod. She moans as he spanks her plump booty and sodomizes her, prying apart her cheeks when he pulls out his prick. The rough anal affair delivers intense throat fucking, rectal gaping, and a sloppy, ass-to-mouth blowjob. Zac spits in her face. He crams a dildo down Rissa's throat while buttfucking her, Rissa hacking and drooling throughout. Zac squeezes his boner between her juicy jugs, treating the sweet teen to a slippery titty fuck. He nails her box and finally finishes adorable Rissa off with a hot cum facial.
RapidgatorK2S