pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
4

Evil Angel - Candee Licious - Rimming-Gaping-a2m Milf

File: jr6aknaevancanlic4grmn3rpll.mp4
Size: 1.60 GB
Duration: 37:04
Resolution: 1920x1080
Format: mp4
Description: Elegant blonde MILF Candee Licious meets stud Lorenzo Viota, and they shoot a series of explicit photos that might get her a job. Things escalate, and soon Candee strips down to her lingerie. They fondle one another and kiss passionately. She sucks his cock, and he greedily fingers her twat. Lorenzo skewers her slit standing up. The muscular fucker lifts her off the ground for an upside-down blowjob! 'I want you to fuck my ass,' says Candee, and Lorenzo does. Candee gives ass-to-mouth head, taking a mouthful of dick straight from her bunghole. Lorenzo pounds her booty in a variety of positions, reaming her cornhole to gaping! Candee masturbates while he slams her sphincter repeatedly. Lorenzo gives her a rim job, too. Climaxing the anal encounter, he spackles Candee with a cum facial. Creamy strands of spunk stream over her lips and chin. She smiles, tasting the mess on her slender fingertips.

Evil Angel - Melissa Stratton - Deepthroat Threesome

File: k7cr7naevanmelstrfav1bptkbn.mp4
Size: 1.68 GB
Duration: 32:32
Resolution: 1920x1080
Format: mp4
Description: Brunette stunner Melissa Stratton models sheer lingerie, teasing seductively through a sleek intro. The orally obsessed hottie parades her fit body and talks dirty about the upcoming scene. Melissa struts, displaying round tits. She soon teams up with director Jonni Darkko and stud Hollywood Cash to give her first-ever double blowjob. Melissa wraps her puffy pink lips around Hollywood's big Black cock, kissing the head before jamming the giant rod down her throat. Jonni steps in to round out the threesome, immediately fucking Melissa's face. Spit oozes out over her breasts as the guys have their way, crudely cramming their cocks into her cakehole through an epic oral scene. The slobber-soaked affair includes deepthroat fellatio and a graphic cum facial. Melissa holds steady as Jonni and Hollywood slather her in hot sperm. Jonni's split-screen replay shows the climax from two different angles!

Evil Angel - Athenea Rose - Sodomy, Gaping, Squirting

File: zjiqtnaevanathrossy3wwbjmzt.mp4
Size: 2.09 GB
Duration: 39:13
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Athenea Rose starts in a silk robe, quickly stripping to reveal big tits. The tattooed hottie fully displays her athletic build and shakes her ass, eagerly anticipating a nasty anal scene. Athenea greets director-performer Angelo Godshack with sloppy kisses, quickly bending over so he can shove his big cock into her pussy. Angelo switches holes, sodomizing young Athenea to moaning ecstasy. When he pulls out his prick, Athenea shows off her wrecked rectum, farting and oozing lube in the process! He chokes her as he roughly fucks box and butthole, resulting in multiple, cunt-squirting orgasms for Athenea! She rims him, deeply tonguing his bunghole, and gives a slobbering, ass-to-mouth blowjob. Athenea laps Angelo's scrotum while he masturbates. Hardcore action includes rounds of immense sphincter gaping! Finally, Angelo's semen splatters Athenea's outstretched tongue, and the satisfied lady swallows.

Evil Angel - Luna Legend - Luna

File: hm6bcnaevanlunlegtgboirt5ww.mp4
Size: 1.81 GB
Duration: 45:45
Resolution: 1920x1080
Format: mp4
Description: Pretty, hot-assed Luna Legend has a striking look with long hair dyed burgundy, a lush-lipped smile, and fabulous tattoo art. She teases outdoors in fetish gear studded leather bra, leather collar with chain leash, leather fetish panties with buckles, and heels. In a voiceover, Luna says she's an influencer and that she's hired photographer Vince Karter to shoot sexy content. She provokes him as he shoots, exposing her body and unveiling his boner. His intimate, POV shots show a hand job blowjob face fuck with dirty talk and piercing eye contact. Indoors, Luna adds a skin-tight red latex skirt over her panties. She masturbates as he fucks her pussy and chokes her. His big cock pokes through the latex to pork her asshole! Vince lowers his crack onto her face for a rim job. With her boobs wrapped in the latex, they share a titty fuck. He alternates reaming all of her holes in various positions, including a full-nelson buttfuck. Luna gives ass-to-mouth head. Vince lubes a gigantic phallus for dickdildo DP. And he pours milk into her rectum through a funnel butt plug! Luna expels the mess all over her derriere. Vince rails her milky sphincter. He cums on her face and tongue.

Evil Angel - Mia Trejsi - Rough DVP & TVP Gangbang

File: dtcupnaevanmiatrevktqeaoqo8.mp4
Size: 2.59 GB
Duration: 39:15
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Mia Trejsi wears a sheer purple top over her slinky black shirt, teasing and stripping to warm up for a rough sex gangbang. The nasty hottie talks dirty to the camera, telling viewers about the debauchery about to take place. Studs Brian Ragnastone, Deny Lou, Max Dior and Michael Fly step in to ravage her! The dudes grope Mia while fucking her wet cunt to intense, squirting orgasms! She drools as the fellas fuck her throat, one and two at a time. Mia rims assholes, too. Next comes freaky double-vaginal penetration and then crazy, triple-vaginal cramming, Mia's sweet snatch simultaneously stuffed with three big cocks! Orgasmic Mia's gash gushes, blasting girl squirt! She leaves the whole crew satisfied For the climax, Mia opens her mouth widely while the guys masturbate one at a time, each spraying a load of hot cum into her waiting mouth. Mia holds her mouth open as the sperm accumulates and then swallows the whole mess! There's more rowdy action exclusively on EvilAngel.com Deny lewdly fists Mia's cunt!

Evil Angel - Alexa Throat - Alexa & Toby

File: hkjbvnaevanalethrmejobazgfa.mp4
Size: 2.05 GB
Duration: 39:02
Resolution: 1920x1080
Format: mp4
Description: Wearing a cut-off T-shirt and pink shorts adorned with hearts, impossibly cute brunette Alexa Throat teases in slow-motion. Dirty director dominant performer Toby Dick immediately takes charge of the doll. He shoots POV-style blowjob footage as she sucks his big cock, which sports a cock ring. Alexa gives aggressive deepthroat service, choking up spit. Toby doles out hard smacks to her ass cheeks. He fucks her pussy as she grinds on top. Toby plows her cunt doggie-style. On all fours, Alexa takes an anal drilling! Foot fetish She tastes her toes while on her back with his prick reaming her rectum! 'On your knees,' commands Toby as the submissive sweetie laps up her flavor via ass-to-mouth fellatio. He pounds her butthole in multiple positions. The crazed session climaxes with a cum facial Alexa extends her tongue to catch the jism splashing her pretty face.

Evil Angel - Nicole Rae - 4-On-1 DVP & Anal Gangbang

File: oqif3naevannicraecwohjjupdl.mp4
Size: 2.68 GB
Duration: 44:37
Resolution: 1920x1080
Format: mp4
Description: Pale brunette Nicole Rae flew to Europe from America for this scene, arriving horny as fuck. The nasty vixen talks dirty as she shows off her body. She masturbates, fingering her wet cunt in anticipation of a rough sex anal gangbang! Aggressive studs Deny Lou, Liam Salvatore, Michael Fly and Perry Layne storm onto the set. The dudes smack, choke, and spit at Nicole while slam-fucking her pussy. She gives rim jobs and sloppy blowjobs as Michael hammers her asshole. The freaky melee ramps up with double-vaginal jamming, Nicole moaning loudly while two pricks stretch her snatch. She gives nasty, ass-to-mouth head through the scene, choking on big cocks. When Liam pulls his long boner from Nicole's gaping anus, she has an intense, squirting orgasm, wildly launching hot girl juice through the air! The heated encounter finally climaxes The guys jack off toward Nicole's open mouth, and she swallows four hot loads of sperm!

Evil Angel - Little Dragon - Out By The Pool

File: gs73tnaevanlitdrax2kvunyuxj.mp4
Size: 2.24 GB
Duration: 46:59
Resolution: 1920x1080
Format: mp4
Description: Out by the pool, delectable honey blonde Little Dragon models for still photos by exciting director award-winning performer Vince Karter. They move indoors. She changes clothes, donning an elegant evening dress as Vince captures sexy tease poses. The photography session becomes something more Vince eats out Little Dragon's hot twat. He slides his stiff prick into her pussy and thrusts away. The enthused girl gives a blowjob, eagerly sucking his big cock. Little Dragon mounts Vince and takes his meat back in her cunt. He slams her slit doggie-style. 'Stick it in my ass,' begs Little Dragon, and Vince obliges her anal hunger, fucking her butthole. Uninhibited Little Dragon goes down for a tasty, ass-to-mouth head job, and she gives a rim job too! She enjoys more backdoor boning in multiple positions. With Vince's pole packed firmly in her bunghole, she stuffs a massive toy into her box for dick dildo double penetration! The action climaxes as Little Dragon masturbates to orgasm and Vince pastes her with a thick, creamy cum facial.

Evil Angel - Jesse Pony - Anal, Cunt Squirt, Creampie

File: 1udgwnaevanjesponna2b6uempi.mp4
Size: 1.73 GB
Duration: 40:11
Resolution: 1920x1080
Format: mp4
Description: Fabulous porn star Jesse Pony wears glamorous lingerie in the opening tease, showing off and caressing her fit body, stripping off her sheer top to reveal her round breasts, and roughly jamming a giant dildo into her wet slit. The nasty girl masturbates to multiple, squirting orgasms, slopping the floor with liquid lust. She hops off the couch and lewdly licks up her mess, referring to herself as a 'bad little bitch'! Jesse welcomes hung stud Jax Slayher with a blowjob, drooling and choking on his lengthy big Black cock. Jax returns the favor with a deep anal reaming. Jesse moans as he power-fucks her asshole, posing her gaping rectum at several points throughout. Her needy cunt continues spraying long-distance fountains of girl squirt as Jax sodomizes her. She gives raunchy, ass-to-mouth head. The rude session delivers intense rod riding and crude gash slamming. Jax fills Jesse's twat with a hot creampie! He scoops the semen from her used vag and feeds it to her!

Evil Angel - Ashley Lane - Anal Gaping & Pussy Squirt

File: bau9snaevanashlanzq1tflmfs5.mp4
Size: 1.49 GB
Duration: 34:44
Resolution: 1920x1080
Format: mp4
Description: Ashley Lane is a tall, dirty blonde with a pussy that can squirt long-distance! The leggy vixen wears glamorous lingerie, stripping and playing with herself through a sweltering tease sequence. Ashley drools and licks her fingers, wetting them to lubricate masturbation. The skillful babe shows director Pat Myne her special squirting talent. Orgasmic Ashley spreads her legs, and using no hands, spews a juicy cunt geyser across the entire room! Big stud Milan Ponjevic soon arrives. The hung dude subjects Ashley to throat fucking and then pounds her gash to more gushing climaxes. When Milan laps up her juice and spits it into Ashley's mouth, she swallows her own nectar! Milan follows up by fucking her butthole, slowly inching his humungous hog into her sphincter. The graphic anal session serves up hard-riding sodomy, a slew of liquid orgasms, and a crude, ass-to-mouth blowjob. Ashley's rectum gapes. Milan finishes her off with a cum facial. Sperm splattering her face, Ashley says, 'I'm a good whore!'

Evil Angel - Adira Allure - Pussy Squirt & Anal Kink

File: nu9hknaevanadiall39gaos7kkj.mp4
Size: 1.50 GB
Duration: 35:27
Resolution: 1920x1080
Format: mp4
Description: Blonde MILF Adira Allure models a sexy green lingerie set, teasing and playing with herself in the opening moments. The short-haired, leggy babe whips out her luscious tits and salivates over her nipples, smiling playfully. She bends over to show her booty, soon revealing the large butt plug packed into her asshole. Adira masturbates to an intense, squirting orgasm, spraying her girl juice all over the camera lens! Hugely hung stud Milan Ponjevic arrives to satisfy the severely horny vixen, cramming his big cock into her cunt straight away. Adira talks dirty while Milan drills her slit. She reciprocates with a raunchy blowjob and a freaky rim job. The action intensifies with lusty anal sex, Adira's gash continuing to gush several long-distance squirt geysers throughout. Hardcore sodomy includes rectal gaping and ass-to-mouth cocksucking. For the climax, Adira laps up Milan's sperm and thanks him.

Evil Angel - Skylar Snow - Pussy Squirt & Anal Kink

File: xviatnaevanskysno7g5w39773t.mp4
Size: 1.32 GB
Duration: 30:45
Resolution: 1920x1080
Format: mp4
Description: Stacked stunner Skylar Snow teases and strips off her lingerie, looking sensational in a steamy intro tease segment. The busty babe stares lustfully as the camera captures multiple, extended views of her gorgeous face, also giving viewers great angles of her juicy booty and big boobs. On the couch, she fingers her wet pussy, provoking a torrential, slit-squirting orgasm. When the girl juice splatters over the lens, Skylar approaches and lewdly licks it clean! She greets superstar stud Vince Karter with a kiss, and the hung dude power-fucks her already soaked gash. Vince quickly moves on to Skylar's asshole, buttfucking the sweet girl to more long-distance squirt showers! This decadent session serves up rod riding, anal gaping and a slobbering, ass-to-mouth blowjob. Skylar gives Vince's huge dick a slippery titty fuck, prefacing a messy cum facial finale.

Evil Angel - Sabien Demonia - First Rosebud Ever

File: ojvkwnaevansabdemvvookki1sy.mp4
Size: 1.29 GB
Duration: 27:43
Resolution: 1920x1080
Format: mp4
Description: Exciting, super-voluptuous XXX director-performer Sabien DeMonia takes on three big studs -- Jesus Reyes, Little Maly and Leo Santos -- in a freaky foursome. Maly carries the tattooed, naked brunette lust bucket on his shoulders and drops her onto the bed. The macho musclemen feed hungry Sabien their big cocks. She grinds on top of Leo while giving Maly a blowjob. Curvaceous, irrepressible Sabien takes a double-anal reaming, two pricks up her ass together, and double penetration, with dicks stuffing her box and butthole simultaneously! She enjoys airtight treatment as boners pack all three holes at once! The melee continues... Leo sucks on her massively big tits. Orgasmic Sabien showers him with girl squirt! Jesus delivers rounds of hard asshole drilling, and Sabien treats him to a sloppy titty fuck while she strokes and sucks the other two rods. All three studs splash Sabien's jiggling jugs with semen, and she sucks their poles clean.

Evil Angel - Priscila Belini - Rough 4-On-1 DP & DAP

File: tzzjvnaevanpribelg8vrvpil7n.mp4
Size: 3.33 GB
Duration: 48:25
Resolution: 1920x1080
Format: mp4
Description: Busty sex freak Priscila Belini wears white lingerie with matching stockings, quickly pulling off her panties to play with her wet pussy. The horny babe shakes her booty for the camera and masturbates, soon welcoming hard studs Brian Ragnastone, Deny Lou, Max Dior, and Michael Fly for a gangbang! The hellacious sex starts quickly as Max, Deny and Brian manhandle Priscila while Michael ruthlessly fucks her throat! The dudes take turns sodomizing the adventurous girl, seriously reaming Priscila's rectum through a graphic anal melee. She rims bungholes and gives nasty, ass-to-mouth blowjobs. And Priscila experiences intense double-anal penetration! The hung, dominant dudes subject her to multiple rounds of rabid, two-dick rectal drilling while spitting, smacking, and choking hot, submissive Priscila! Action features immense sphincter gaping! Finally, the guys slather Priscila's mouth in four juicy loads, and she swallows the hot sperm.

Evil Angel - Scarlet Chase - Pussy Chastity Anal Only V2

File: uxgcwnaevanscachaw5efqqns2d.mp4
Size: 1.02 GB
Duration: 19:20
Resolution: 1920x1080
Format: mp4
Description: Gorgeous Internet star Scarlet Chase is as kinky as they cum... The breathtaking babe wears latex fetish gear, giving us a step-by-step view as she locks her wet pussy in a chastity device! Scarlet tosses the key and performs a sexy tease, raising the heat. The chastity apparatus keeps Scarlet's cunt locked up, but leaves a carefully placed hole for access to her asshole. She stuffs a butt plug in her rectum to stretch it out, soon welcoming partner Elic Chase into view. Elic sodomizes the sweet girl on the couch, smacking her perfectly shaped booty as he reams her butthole. Scarlet gives a nasty, ass-to-mouth blowjob. She frequently flaunts her gaping bunghole through this hot anal encounter. The decadent affair features throat fucking, intense backdoor rod riding and lewd farting. Elic cums on the stunning girl, splattering her big tits with a hot load of semen. She shows off her creamy reward and gives Elic's dick one final suck.

Evil Angel - Naomi Ryder - Studentatrix

File: cxftpnaevannaoryd7oyv1jn1oh.mp4
Size: 1.38 GB
Duration: 35:41
Resolution: 1920x1080
Format: mp4
Description: Blonde bombshell Naomi is failing Mr. King's class, but that shouldn't be a problem for her because she's hot. Hot girls ALWAYS get A's, but especially since she knows about Mr. King's little secret--that he's a pathetic, ass-worshipping regular who spends hundreds in the VIP room at the strip club where she dances. In this intense facesitting scene, Naomi corners the nervous professor after class, locks the lecture hall door, and quickly turns the tables by reminding him how much time he spends at the strip club sniffing girls' assholes! She orders the married Mr. King to his knees, making him desperately lick and worship her ass, feet, and pussy while she grinds on his face, verbally humiliating him the entire time until he's a broken, obedient mess willing to change every failing grade to an A in exchange for more of her superior body.

Evil Angel - Vanna Bardot - Anal & Cum Facial POV

File: ctam6naevanvanbardwowajsuuu.mp4
Size: 1.32 GB
Duration: 30:44
Resolution: 1920x1080
Format: mp4
Description: Sexy XXX star Vanna Bardot teases in lingerie, stripping and posing to warm up for a raunchy anal session with director-performer Jonni Darkko. The young brunette bends over to show us her tight asshole, spanking her supple butt cheeks. Vanna goes upstairs to greet Jonni with a messy blowjob. Slobber oozes from her pink lips as she sucks cock. Graphic throat drilling leads to intense buttfucking, and Jonni's intimate POV cam puts viewers practically in the scene. Vanna talks dirty while Jonni slams her stretched sphincter. She pries apart her rear cheeks and poses whenever Jonni pulls his boner out of her butthole. Heated sodomy climaxes with a graphic cum facial. Vanna closes her eyes with the head of Jonni's dick millimeters from her forehead, and she opens her mouth widely as his sperm seeps down her beautiful face. For an epic finale, Jonni offers a recap, showing multiple angles of the cum facial.

Evil Angel - Stella Luxx - Anal Gaping & A2m Bj POV

File: av5p2naevansteluxzrjkpnmzdb.mp4
Size: 1.14 GB
Duration: 26:40
Resolution: 1920x1080
Format: mp4
Description: Young redhead Stella Luxx wears see-through lingerie in a hot intro, teasing and showing off her hot body. Stella completes her stellar look with fishnets and high-heeled boots, shaking her lusciously plump rump while playfully flirting with the camera. The pretty porn performer lies spread-eagle, cramming a black dildo into her colon! Stella talks dirty while proudly posing her gaping rectum, eager for director-performer Jonni Darkko's stiff dick. She chokes while giving him a blowjob, drooling crudely as Jonni fucks her throat. Next, Jonni stuffs his prick into her sphincter, Stella coaching him as he slithers his shaft deep inside. His graphic, POV-style camera work put rude anal reaming and a sloppy, ass-to-mouth blowjob practically in the viewer's face! Jonni finishes Stella off with a messy cum facial. He uses his still-swollen rod to scoop excess spunk into Stella's mouth, and the sweet girl smiles as the sperm drips down her cheeks.

Evil Angel - Ivy Ireland - Buttfucking & Gaping POV

File: igqennaevanivyireu4ifsfb4rb.mp4
Size: 1.44 GB
Duration: 33:32
Resolution: 1920x1080
Format: mp4
Description: Top porn star Ivy Ireland rocks sexy, see-through lingerie with matching fishnets and heels. The athletic vixen shakes and shows off to gear up for lewd sodomy with director-performer Jonni Darkko, whose intimate, POV-style shooting captures the action. Ivy spreads her legs on a chair and jams a gigantic black dildo into her asshole, with Jonni offering a helping hand when needed. Her rectum quickly tightens when she pulls the huge toy out. Ivy tastes her anal flavor, sucking the toy ass-to-mouth. Jonni soon stuffs his shaft inside her butthole, pounding Ivy's booty while she talks dirty. The intense backdoor session serves up rectal gaping and a slobbering blowjob, plus multiple, up-close, very personal views of Ivy's luscious butthole. In the finale, Ivy drops to her knees for a nasty cum facial. Jonni drains his balls, and his splooge creams Ivy's gorgeous face as she smiles with satisfaction.

Evil Angel - Kitty Li - 4-On-1 Rough DP, DVP & DAP

File: 1nv36naevankitlihuagytrsd5.mp4
Size: 3.36 GB
Duration: 50:31
Resolution: 1920x1080
Format: mp4
Description: Cute blonde Kitty Li wears a tiny pink top with tight black leggings. She strips and masturbates to start, prying apart her chunky butt cheeks to flaunt her open sphincter. Director Angelo Godshack storms onto set with hung studs Brian Ragnastone, John Price and Michael Fly. Orgasmic Kitty rides Angelo's throbbing rod her pussy repeatedly ejaculates girl squirt as he ruthlessly sodomizes her! The dudes choke and slap Kitty through an anal gangbang, using every one of her orifices. Kitty gives rim jobs and sloppy, ass-to-mouth blowjobs, choking and wailing through this sordid action. The guys subject her to serious double penetration pounding intense, double-anal reaming and athletic, double-vaginal stuffing! The irrepressible vixen enjoys a melee of rough sex and multiple, twat-gushing orgasms. This epic encounter delivers wide rectal gaping and a creamy climax On her knees, sweet, disheveled Kitty smiles and opens her mouth as all four guys jack off over her. Once she gets the semen collected in her mouth, she swallows it down!

Evil Angel - Aviana Violet - Anal Gaping & A2m POV

File: xjwycnaevanaviviowcfqx8ysh8.mp4
Size: 1.62 GB
Duration: 34:41
Resolution: 1920x1080
Format: mp4
Description: Aviana Violet's massive tits spill from her tight bra as the bodacious babe performs a heated opening tease. The steamy intro features Aviana in glamorous black lingerie with matching stripper heels, licking her luscious, glossy lips and looking into the POV camera. She spreads her legs, giving viewers a glimpse of her juicy asshole. Director-performer Jonni Darkko assists her, cramming a large dildo into Aviana's anus to prepare her for his stiff prick. She talks dirty when he pumps his pole inside of her, whimpering through an intense anal railing. The freaky bout delivers sloppy deepthroat head lewd rectal gaping and a messy, ass-to-mouth blowjob. Climaxing a nasty, face fuck, Jonni decorates Aviana with a gooey cum facial. The sweet girl smiles and lewdly drools as sperm runs from her forehead, down her cheeks to her mouth. Jonni's slow-motion, split-screen photography details the graphic cum shot.

Evil Angel - Amirah Adara - Squirt, DP & Creampies

File: kycyonaevanamiadaovno7xwrg5.mp4
Size: 3.58 GB
Duration: 50:16
Resolution: 1920x1080
Format: mp4
Description: Wearing pink jean shorts and a casual top, pretty porn star Amirah Adara caresses her tight, athletic body. The brunette temptress strips and teases, anticipating a rough sex gangbang! Amirah poses her thick booty for the camera, prying apart her plump cheeks to reveal the stretched-open sphincter beneath her panties. Dominant studs Deny Lou, Max Dior and Michael Fly storm onto the scene, immediately sodomizing Amirah! She smiles and moans as Max jackhammers her rectum, proudly posing her gaping anus multiple times.

Things get hectic As Deny drills her asshole, Max chokes and smacks her while she rims Michael! The spit-wet anal foursome includes raunchy, ass-to-mouth blowjobs, serious throat fucking and hard double penetration pounding! Orgasmic Amirah's twat ejaculates blasts of girl squirt! Finally, the guys fill her gash with creampies! Amirah scoops up the cum oozing from her satisfied cunt and tastes it on her fingers.

Evil Angel - Sabien Demonia - First DAP

File: zu2vhnaevansabdemmb3r9cfdcx.mp4
Size: 1.41 GB
Duration: 32:47
Resolution: 1920x1080
Format: mp4
Description: Extremely voluptuous XXX director-star Sabien DeMonia flaunts her thrillingly curvaceous body encased in a tight, shiny red fetish dress. She bends over to show off her huge, naked ass. Sabien summons studs Jesus Reyes and Little Maly. Her big tits flop from her top. Maly lifts the bodacious, tattooed babe bodily. Sabien squats to suck their hard dicks. Foot fetish The guys peel off her pumps and rub their pricks on her bare soles. Next, Jesus fucks Sabien's pussy. She takes a hard anal slamming from Maly. Orgasmic Sabien unleashes a flood of girl squirt! She gives Maly an ass-to-mouth blowjob, and then he drills her bunghole some more. The decadent threesome intensifies as Sabien enjoys double penetration! More squirting and DP lead to Sabien's very first double-anal reaming -- she packs both pricks in her rectum at once! Maly's cum splashes her open mouth. She takes Jesus' meat in her sloppy cleavage for a titty fuck. His cream explodes into her mouth, and Sabien drools the spunk over her thrill ride body.

Evil Angel - Jennifer White - Dick-Dildo DAP POV

File: 5nysynaevanjenwhis9ay7vyyxj.mp4
Size: 1.75 GB
Duration: 33:49
Resolution: 1920x1080
Format: mp4
Description: Award-winning XXX superstar Jennifer White poses in skimpy lingerie, whipping out her big tits in a steamy tease sequence. Jennifer shakes her round booty and shows herself off before teaming up with director-performer Jonni Darkko for raunchy anal sex shot POV-style. She warms up her sphincter with a huge black dildo. Jonni slides his shaft up Jennifer's ass as his camera gives us an intimate view, practically putting the audience into the action. Jennifer pries open her butthole several times, holding onto her juicy cheeks while we get a close-up view of her gaping rectum. Things ramp up with dick-dildo double penetration and DAP drilling! The decadent affair wraps up with a sloppy, ass-to-mouth blowjob and a slobber-soaked titty fuck. Jonni rewards the beautiful babe with a massive cum facial, sperm dripping down her forehead and cheeks as she gives him a few final sucks.

Evil Angel - Megan Love - Rough DP, DAP & Creampies

File: uonqpnaevanmeglovqsmkkkrifw.mp4
Size: 3.20 GB
Duration: 51:36
Resolution: 1920x1080
Format: mp4
Description: Megan Love is a frisky doll that loves rough sex! Starting in lingerie with knee-high socks, the young vixen strips and masturbates. She looks into the camera to say, 'I want to get punished! Hardcore studs Deny Lou, Mark Dozer, Max Dior and Michael Fly have what she needs. One guy sodomizes her while the others slap her and fuck her throat. The dudes use her holes fiercely. Indestructible Megan salivates while giving a graphic, ass-to-mouth blowjob. She keeps encouraging the studs as they manhandle her aggressively. Megan rims bunghole and rides dick through an epic anal gangbang, posing her gaping rectum when it isn't stuffed with big cock. The nastiness ramps up with hard double penetration and intense, double-anal reaming! Megan smiles proudly as the men smack, choke and spit on her. They pump gooey creampies into her cunt. As semen seeps from her slit and over her sphincter, Megan smirks and flips off viewers. Exclusively on EvilAngel.com, the scene includes fisting content -- Deny fists Megan's twat while Max shoves his foot in her mouth!

Evil Angel - Stephanie Love - Anal Gaping & Squirt

File: ctkzznaevanstelovchlpxdf6f3.mp4
Size: 1.83 GB
Duration: 35:50
Resolution: 1920x1080
Format: mp4
Description: Bodacious blonde Stephanie Love is serious about her job as a social media consultant for director Vince Karter. But the busty, tattooed vixen finds herself overcome with lust, leading to a heated fantasy about Vince... In fetish-style lingerie, she makes out with the hung stud. Stephanie kneels to worship his big cock with a slobbering blowjob. Vince rudely drills her sweet mouth. He warms up her asshole with a rim job and then stuffs his pole into her wet cunt. Stephanie's gigantic booty bounces as Vince power-plows her pussy. He chokes the thick chick during a rough, manhandling anal fuck. Rabid buttfucking leaves orgasmic Stephanie ejaculating multiple blasts of girl squirt! She offers messy, ass-to-mouth cocksucking. Vince pries apart her massive rear cheeks to show off her gaping anus in the process, he blows a premature load over her plump rump! Vince forges on, satisfying Stephanie with dick-dildo double penetration. She treats him to a rim job and a slick titty fuck. He paints her with a cum facial.

Evil Angel - Nicole Nichols - Anal Gaping & A2m Bj

File: aevgmnaevannicnicgdkfhtptwp.mp4
Size: 2.18 GB
Duration: 33:00
Resolution: 1920x1080
Format: mp4
Description: Slender, flashy platinum blonde Nicole Nichols teases in a delicate, black lace corset with panties and matching, sexy pumps. She doffs her top, revealing tiny, natural breasts she pulls her panties down and shakes her delectable ass. Young Nicole sucks on a rainbow-colored dildo and then slides the wet toy up her sphincter to loosen it. Co-director performer Mark Wood fucks her pussy doggie-style. She gives him a frantic blowjob. Nicole gets back on all fours and takes an anal reaming. She sucks his thick boner ass-to-mouth, with gusto! Nicole takes a bouncing backdoor ride on Mark's meat. He pounds her rectum more, in multiple positions. Nicole's asshole gapes!She gives Mark more skillful oral service, pushing him over the brink. He blasts her with a cum facial, splooge splashing her tongue and dripping from her chin. Pretty Nicole swallows some of the mess.

Evil Angel - Priscila Belini - DVP, DAP, TVP & TAP

File: cbuqnnaevanpribel9bevzeofwb.mp4
Size: 4.01 GB
Duration: 56:57
Resolution: 1920x1080
Format: mp4
Description: With her tiny, pink top pulled down to reveal her tits, horny vixen Priscila Belini masturbates on the couch, moaning as her wet cunt sloshes loudly. The long-legged girl's fishnets match her lingerie. Without a moment's notice, studs Michael Fly, Neeo, Brian Ragnastone and Mark Dozer storm onto the scene, ready to serve up the rough sex she loves. The men immediately sodomize Priscila! They take turns slam-fucking her sphincter and drilling her pussy while smacking her. This intense gangbang delivers serious, ass-to-mouth throat fucking immense rectal gaping and double-vaginal penetration! Priscila lewdly rims bungholes. Things really ramp up when Neeo and Michael subject Priscila to double-anal reaming. Big cocks fill her rectum, and the vixen indulges in even nastier fun -- next up is triple-vaginal jamming, followed by a wild triple-anal cramming! Each of the guys crudely rewards Priscila with a load of semen.

Evil Angel - Jadilica - Anal 3-Way With 2 Clinicians

File: sunzbnaevanjadisa8r2o9kvb.mp4
Size: 1.67 GB
Duration: 50:05
Resolution: 1920x1080
Format: mp4
Description: On the grounds of Rocco Siffredi's luxurious sex clinic, staffers Lorenzo Viota and Francis X discuss the mounting stress of their jobs. Indoors, Lorenzo argues with his girlfriend, bespectacled brunette Jadilica. That leads to passionate kissing as they peel off their lab coats. While Jadilica gives him a blowjob, Francis watches them, masturbating. Jadilica takes Francis' prick in her mouth, and a threesome is underway! Lorenzo gives his girlfriend a rim job. He smashes her pussy while she sucks Francis' meat. Francis nails her twat. The flexible doll squats down on Lorenzo's bone for an anal reaming! Next, Francis takes a turn porking hot Jadilca's asshole. She tastes her flavor via ass-to-mouth cocksucking! The men trade her mouth and butthole in several positions. Francis showers Jadilca's pretty, open mouth with spunk. Lorenzo cums next, spunking on her rear.