pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
14

Evil Angel - Emily Pink & Mia Trejsi - Anal Workout 3-Way

File: q2hunnaevanemimialxstzheuv2.mp4
Size: 2.43 GB
Duration: 35:59
Resolution: 1920x1080
Format: mp4
Description: Fitness Coach Lorenzo Viota trains dark-haired, athletic babes Emily Pink and Mia Trejsi, working them out with an exhausting run through the city streets. As a reward for hard work, he brings them to his posh apartment, where they can unwind in the jacuzzi. In the tub, the horny girls make out, caressing each other's body. Things get steamier, with Mia jamming her fingers up Emily's asshole. They passionately kiss and eat pussy through a sweltering lesbian soiree. He's surprised by what he sees, but Lorenzo quickly joins the girls when Emily and Mia proposition him. The girls collaborate on a double blowjob, drooling, and Lorenzo fucks their faces. Mia moans when he ruthlessly sodomizes her, and Emily pulls out his prick to give crude, ass-to-mouth head! The anal threesome delivers lewd, girl-girl rimming, intense pussy fucking, and a cum facial finish. Lorenzo drips hot sperm over his trainees, who swap semen orally.
RapidgatorK2S

Evil Angel - Megan Inky & Eden Ivy - Lesbian Shower Toy Party

File: cawennaevanmegedehqu9uwt16q.mp4
Size: 1.24 GB
Duration: 25:16
Resolution: 1920x1080
Format: mp4
Description: Director Proxy Paige and a group of hot porn friends take an exciting anal excursion. Proxy gives Euro babes Megan Inky and Monika Wild a lift to a secluded cabin in the woods, where they meet up with stars Kristy Black and Eden Ivy. Everyone settles in for an evening of board games and conversation. The next morning, the camera catches Eden masturbating in the shower. The tattooed beauty sodomizes herself using a humongous suction dildo stuck to the shower door! Busty Megan joins the fun in the following moments, slurping Eden's phallus while Eden massages Megan's massive breasts. The insatiable girls lube up huge toys to slide them in and out of their wet holes, in turns cramming them into each other's rectum. Impromptu lesbian fun features rim jobs, ass-to-mouth flavor and immense backdoor gaping! Eventually, Kristy and Proxy enter the bathroom, sadly breaking up the party.
RapidgatorK2S

Evil Angel - Penelope Woods - Anal Fuck, Pussy Squirt

File: bz2txnaevanpenwoo8ulm3z4bke.mp4
Size: 1.60 GB
Duration: 37:15
Resolution: 1920x1080
Format: mp4
Description: Sweet, dark-haired Penelope Woods teases in a bright green bikini with a choker and clear heels. The young, natural-bodied sex freak strips and spreads her holes, eagerly showing off her perky tits and freshly shaved slit. She crams a dildo up her ass while talking dirty to the camera, encouraging viewers to jack off. Hot anal masturbation warms her up for super-hung Vince Karter. The top stud spanks Penelope's plump rump while fucking her butthole. She takes a fuck ride with his big cock reaming her pussy. Penelope slobbers while giving a nasty, ass-to-mouth blowjob, loudly declaring, 'I can taste my asshole on that cock!' Intense, all-holes action delivers hard-choking fellatio, rectal gaping and dickdildo double penetration! Vince fingers Penelope's pussy to a squirting orgasm! He blasts a hot load over her fluffy, pink lips. Following the creamy cum facial, Penelope spreads her worn out holes.
RapidgatorK2S

Evil Angel - Brianna Arson - Gaping, Squirting Badass

File: d8xhenaevanbriarsisjhkoru9i.mp4
Size: 1.72 GB
Duration: 40:00
Resolution: 1920x1080
Format: mp4
Description: Young, outrageous starlet Brianna Arson might look sweet and innocent, but this little cutie is a badass! She loves showing the world her raunchy skills. Brianna joins massively hung Vince Karter in an epic backdoor matchup. The oversexed brunette teases, masturbating her wet pussy while talking dirty to the camera. Brianna slobbers over her fingers and shoves them up her asshole. She welcomes Vince with a choking blowjob. The petite vixen can barely get his jumbo pole half-way down her throat, so Vince mashes her head into his crotch, ruthlessly fucking her face! Hardcore action progresses with serious slit slamming and Brianna's multiple, squirting orgasms! She whimpers when Vince rails her hot butt, rudely rubbing her clit through an intense anal reaming. The brazen hottie rims his bunghole and gives nasty, ass-to-mouth fellatio the rough fucker smacks her, spits on her and sodomizes her till she's a sloppy, gaping mess! Brianna takes a cum facial, scooping up semen and swallowing!
RapidgatorK2S

Evil Angel - Stella Luxx - Rowdy Anal Gaping & A2m

File: cww29naevanstelux8ongksfyib.mp4
Size: 1.41 GB
Duration: 32:46
Resolution: 1920x1080
Format: mp4
Description: Young, slender redhead Stella Luxx looks stunning in a tiny blue bikini, her long locks extending to her hot butt. The freckled fuck doll poses, strips and stretches her holes through a sassy tease sequence, and she warms up her sphincter by stuffing a large toy inside. Sexy Stella greets pro stud Zac Wild with a kiss. He rims her anus, and she chokes on his stiff shaft when the aggressive dude fucks her throat. Next, Zac pounds Stella's sweet slit. She hops on his lap for rowdy backdoor ride. Stella's rough anal session serves up dirty talk a messy, ass-to-mouth blowjob and rude rectal gaping! The foul-mouthed babe opens her legs as Zac yanks his prick from her butthole, spreading herself open to provide a landing spot for his semen. He pumps cum over her wrecked cunt and freshly fucked bunghole. Stella scoops up the semen, tasting her creamy reward.
RapidgatorK2S

Evil Angel - Emma Rosie - She Depraved Anal & Cum Facial

File: jmgm6naevanemmrosb7vl4rlfxg.mp4
Size: 1.40 GB
Duration: 32:34
Resolution: 1920x1080
Format: mp4
Description: Petite, tattooed tart Emma Rosie is infatuated with anal sex. The darling young blonde strips and poses, stretching her holes to show that her rectum is ready for reaming. Emma flaunts her perky tits and long, sexy legs, talking dirty to the camera as she ferociously finger-fucks her asshole. Enter Zac Wild -- the aggressive stud's boner, plunges straight into Emma's slobbering mouth. Zac ruthlessly fucks her throat, smacking her booty while thrusting his shaft in and out. The rough blowjob leads to cunt clobbering copulation. Zac picks Emma up and pounds her like a rag doll! Blistering backdoor sex comes with epic gaping and nasty, ass-to-mouth fellatio. Drooling Emma constantly uses vulgar language through this utterly depraved session. On her knees, Emma pries open her eyelids as Zac looms overhead, jerking off. He sprays sperm into her eyes as part of a messy cum facial. Emma scoops up the semen, giving thanks.
RapidgatorK2S

Evil Angel - Veronica Leal & Rebecca Volpetti - Office Anal 3-Way

File: 91t1vnaevanverrebaqbqarbrob.mp4
Size: 2.14 GB
Duration: 42:58
Resolution: 1920x1080
Format: mp4
Description: Sexy real estate agent Veronica Leal chats with associate Darrell Deeps, eager for a lunch date with girlfriend Rebecca Volpetti. The girls ask Darrell to join them, but much to their surprise, he declines, opting to relax at the office. As he dozes off, the beautiful babes appear in a vision... Wearing matching lingerie, they share a kinky lesbian tryst, eating pussy and rimming ass. Darrell enjoys the show as the girls passionately kiss and caress one another. Veronica and Rebecca crawl to Darrell to worship his big Black cock. They give a nasty double blowjob. Next, Darrell bangs them on the bed. He pounds Rebecca's cunt while she eats Veronica, and the girls take turns with his dick. Intense slit slamming leads to furious anal sex, Veronica whimpering as she rides rod. Both babes give drooling, ass-to-mouth fellatio, and in a messy climax, they swap semen orally and swallow it! This erotic threesome includes freaky foot fetish.
RapidgatorK2S

Evil Angel - Scarlet Chase - Anal Makes Schoolgirl Squirt

File: zih6enaevanscachalfr4sis61u.mp4
Size: 938.28 MB
Duration: 23:37
Resolution: 1920x1080
Format: mp4
Description: This scene premieres exclusively on EvilAngel.com! Busty stunner Scarlet Chase shows off her gorgeous, athletic frame in skimpy schoolgirl attire, teasing on the bed to start. Scarlet twirls her pigtails and shakes her juicy booty, flaunting the butt plug wedged in her anus beneath her slinky thong panties. She spits on her big tits and strips off her bottoms, masturbating to prep for Elic Chase's diamond-hard dick. Friendly, fun loving Scarlet greets the lucky stud with a messy, thorough blowjob, worshiping his veiny prick with every slurp. The insatiable beauty hops onto his pole, whimpering while stuffing his thick boner into her butthole. Scarlet plays with herself while Elic sodomizes her to orgasm -- Scarlet's pussy ejaculates a flood of girl squirt! Fevered anal reaming leads to multiple, cunt-gushing geysers and comes with sloppy, ass-to-mouth fellatio. The climax is a cum facial. While Elic's rod oozes semen, Scarlet's slit spews! And she swallows the semen!
RapidgatorK2S

Evil Angel - Linda Leclair & Nicole Love - Besties' Anal Threesome

File: 82qmrnaevanlinnicafdhxrly2c.mp4
Size: 1.53 GB
Duration: 35:43
Resolution: 1920x1080
Format: mp4
Description: Wearing a short skirt with high heels, bodacious model Nicole Love waits on a park bench for her best friend, tall, leggy Linda Leclair. The girls embrace and then go to Linda's home. Linda introduces Nicole to her husband, director David Perry, who leaves to run some errands. The excited ladies share a kinky lesbian session! Linda shows off her new boob job, and Nicole gropes the enhanced tits. Nicole probes Linda's gash and tastes the juice on her fingers. They finger each other's anus, whimpering through intense girl-girl stimulation. When David returns, the girls treat him to a wet double blowjob. The action heats up with hard anal drilling as the girls kiss. David sodomizes Nicole, and Linda gives nasty, ass-to-mouth fellatio. The fun-loving anal threesome delivers pussy fucking, rod riding and a cum facial. Nicole and Linda extend their tongues as David sprays them with sperm.
RapidgatorK2S

Evil Angel - Candee Licious & Zazie Skymm - Lesbian & Anal 3-Way

File: 5d6qlnaevancanzazzdfjtjujhb.mp4
Size: 1.73 GB
Duration: 40:05
Resolution: 1920x1080
Format: mp4
Description: Blonde cuties Candee Licious and Zazie Skymm meet director David Perry for a professional erotic photoshoot. The tight-bodied twosome talks with David about outfit ideas, eventually choosing matching pink lingerie sets. As the babes slip into the gear, they admit to a crush on the lucky photographer. They kiss before entering the studio, where David eagerly awaits. The wild duo surprises David, stripping and making out, letting him know that he can watch. At first angry, David warms up when Zazie and Candee invite him to join them. The porn pro feeds the hotties his boner they drool and choke through a double blowjob. Candee and Zazie share lesbian 69 while David sodomizes Zazie, with Candee eating pussy and giving nasty, ass-to-mouth head! The heated anal threesome includes rectal gaping, intense cunt fucking and more kink. Zazie laps David's ball sack while he pummels Candee's sphincter, and she deepthroats his dick! The girls slurp and orally swap David's cum.
RapidgatorK2S

Evil Angel - Mia Trejsi & Emily Pink - Sweaty Anal Workout 3-Way

File: h3ezpnaevanmiaemiufrqbiuwkb.mp4
Size: 1.54 GB
Duration: 36:00
Resolution: 1920x1080
Format: mp4
Description: Fitness Coach Lorenzo Viota trains dark-haired, athletic babes Emily Pink and Mia Trejsi, working them out with an exhausting run through the city streets. As a reward for hard work, he brings them to his posh apartment, where they can unwind in the jacuzzi. In the tub, the horny girls make out, caressing each other's body. Things get steamier, with Mia jamming her fingers up Emily's asshole. They passionately kiss and eat pussy through a sweltering lesbian soiree. He's surprised by what he sees, but Lorenzo quickly joins the girls when Emily and Mia proposition him. The girls collaborate on a double blowjob, drooling, and Lorenzo fucks their faces. Mia moans when he ruthlessly sodomizes her, and Emily pulls out his prick to give crude, ass-to-mouth head! The anal threesome delivers lewd, girl-girl rimming, intense pussy fucking, and a cum facial finish. Lorenzo drips hot sperm over his trainees, who swap semen orally.
RapidgatorK2S

Evil Angel - Rebecca Volpetti & Veronica Leal - Office Anal 3-Way

File: snunhnaevanrebverc9zivjmlfg.mp4
Size: 1.84 GB
Duration: 42:59
Resolution: 1920x1080
Format: mp4
Description: Sexy real estate agent Veronica Leal chats with associate Darrell Deeps, eager for a lunch date with girlfriend Rebecca Volpetti. The girls ask Darrell to join them, but much to their surprise, he declines, opting to relax at the office. As he dozes off, the beautiful babes appear in a vision... Wearing matching lingerie, they share a kinky lesbian tryst, eating pussy and rimming ass. Darrell enjoys the show as the girls passionately kiss and caress one another. Veronica and Rebecca crawl to Darrell to worship his big Black cock. They give a nasty double blowjob. Next, Darrell bangs them on the bed. He pounds Rebecca's cunt while she eats Veronica, and the girls take turns with his dick. Intense slit slamming leads to furious anal sex, Veronica whimpering as she rides rod. Both babes give drooling, ass-to-mouth fellatio, and in a messy climax, they swap semen orally and swallow it! This erotic threesome includes freaky foot fetish.
RapidgatorK2S

Evil Angel - Miss Raquel - Kneeling Bj, Messy Facial

File: 2wrkgnaevanmisraqeoffppnt6q.mp4
Size: 872.66 MB
Duration: 19:58
Resolution: 1920x1080
Format: mp4
Description: Busty MILF Miss Raquel seems to have cock on the brain. The thickly curvaceous fellatrix teams up with porn pro Mark Wood for a nasty oral session. First comes a twerking tease sequence -- wearing lingerie, Miss Raquel shakes her plump caboose for the camera. She strips and caresses her tantalizing body. When Mark enters the frame, Miss Raquel immediately drops to her knees. Mark stuffs his meat into her mouth and reams her throat, with Raquel obediently lapping his balls and worshiping his boner. The deviant dude grips her hair for leverage, slam-fucking Raquel's gullet through a raunchy blowjob. Messy fucking fellatio climaxes with a creamy cum facial. Sperm drips from Miss Raquel's mouth. 'So fucking amazing!' says the impressed vixen.
RapidgatorK2S

Evil Angel - Chanel Camryn - Hot Testicle Tongue Bath

File: 2tkmdnaevanchacamxtfrvarnkq.mp4
Size: 1.36 GB
Duration: 31:48
Resolution: 1920x1080
Format: mp4
Description: Petite, cute brunette Chanel Camryn teases, peeling off her dainty, lace lingerie for director Jonni Darkko's skilled camera. She worships muscular stud Milan's cock and balls. Camryn slobbers gobs of spit onto Milan's nut sack as she strokes his tool. And the nasty girl rims his asshole. Jonni joins the fun -- his lens captures the action as she gives his testicles a swirling tongue bath! Camryn strokes both erect pricks and stuffs her mouth with scrotums.

She trades their boners back and forth, giving messy blowjobs and feeding on their hanging bags. The slobber-soaked BJ threesome intensifies as thick saliva coats Camryn's pretty face! Her relentless fellatio brings things to a wet climax The guys drench Camryn in sloppy cum facials. The cocksucking and nut licking conclude as Camryn performs a dual BJ clean-off, licking up surplus semen.
RapidgatorK2S

Evil Angel - Francesca Le - Big-Cock Anal Affair

File: c28xfnaevanfrale7hzpo3t72c.mp4
Size: 1.53 GB
Duration: 35:42
Resolution: 1920x1080
Format: mp4
Description: Freaky MILF Francesca Le's husband is away on business, so the buxom stunner meets young stud Parker Ambrose in a ritzy hotel room for a kinky anal affair. They make out, kissing and caressing to initiate their afternoon tryst. Francesca pulls out his seriously big cock and treats him to a slobbering blowjob, choking and lapping his balls. She sits on his lap, slowly stuffing his humongous erection into her hungry pussy.

Francesca rides his rod, and she tastes her juice on his jumbo slab of wet meat. She whimpers when Parker pounds his pud into her anus. The horny couple enjoys intense backdoor boning, with Francesca pausing to give drooling, ass-to-mouth fellatio. The cheating lovers get extra kinky with rectal gaping and spanking. Parker splashes Francesca with a cum facial. Splooge drips down her cheeks, and she uses Parker's prick to scoop up semen and swallow it down!
RapidgatorK2S

Evil Angel - Chloe Amour - Sloppy Bj & Ball Lapping

File: fgqulnaevanchlamo41hi5r3ina.mp4
Size: 1.51 GB
Duration: 35:14
Resolution: 1920x1080
Format: mp4
Description: Breathtaking brunette Chloe Amour dazzles in violet lingerie. The tantalizing babe teases, writhing on a white couch. She takes on lucky studs Donny Sins and Milan plus director Jonni Darkko in a nasty oral foursome. The scintillating siren gives Donny a blowjob. She sucks on Milan's scrotum, spit sluicing from his nuts. Chloe laps Jonni's testicles. She feeds on a buffet of boners and balls, gluttonously stuffing her mouth.

Exhibitionistic, pervy Chloe salivates through frenzied fellatio. She plays with her bouncy boobs as she spit-polishes pricks. The guys take turns fucking her mouth as gobs of slobber overflow onto her chin and down her torso! The action climaxes as she strokes the three rods till they spew! Jonni splashes her forehead with a hot load. Donny and Milan bathe our heroine in glorious cum facials.
RapidgatorK2S

Evil Angel - Sadie Summers - Bjs, Balls & Rim Service

File: gw7xanaevansadsum4nbkuoyo1q.mp4
Size: 1.09 GB
Duration: 25:29
Resolution: 1920x1080
Format: mp4
Description: Knockout blonde MILF Sadie Summers tempts in pink bikini lingerie and white heels. The vixen teases stylish director Jonni Darkko's camera. She drops her top to show off her big tits. 'I wanna worship a whole bunch of hot balls with my mouth,' says dirty-talking Sadie. She licks muscular Milan's scrotum and strokes his boner. Sadie gives stud Donny Sins a raunchy blowjob. The lady takes Dwayne Foxxx's big Black cock in her sultry mouth. Head jobs come with a cleavage-cramming titty fuck. Sadie smiles as she gives each meaty pole her intimate attention. She spit-shines Milan's asshole with a freaky rim job. Next, she worships Dwayne's nut sack and tongues his bunghole! Rounds of oral worship culminate in a creamy climax The guys jerk their joints till they soak horny Sadie with a fantastic cum facial flourish!
RapidgatorK2S

Evil Angel - Arabelle Raphael - Ball-Licking Blowbang

File: pnxsinaevanararaprpejmozmsu.mp4
Size: 1.71 GB
Duration: 39:51
Resolution: 1920x1080
Format: mp4
Description: Voluptuous oral artist Arabelle Raphael flaunts her heavily tattooed bod in a Leopard print bikini, and she lets her mammoth, natural jugs flop out. Five dudes surround the lush-lipped bombshell, stroking their boners, ready for a lewd blowbang! Arabelle sucks Chocolate God's ball sack. She gives Milan a blowjob while the other guys grope and feel her. Arabelle worships Donny Sins and Apollo Banks' scrotums. She deepthroats meat poles in a frenzy of perversity!

Strands of spit spill out onto her pendulous melons. Arabelle wraps her slobber-lubed big boobs around a dick for a rapid, slick titty fuck! The insatiable lady laps sweaty balls with skill and lust. Director Jonni Darkko joins the decadent fun, shooting POV-style footage as insatiable Arabelle gives him head. She dribbles long strands of saliva as she feeds on every cock. In a spectacular climax, the guys splatter Arabelle with a sticky tsunami of cum facials!
RapidgatorK2S

Evil Angel - Sweet Vicky - Dirty Blonde Booty Hottie

File: tkjwsnaevanswevic58nzki67wx.mp4
Size: 1.75 GB
Duration: 40:45
Resolution: 1920x1080
Format: mp4
Description: Sweet Vickie is a busty, athletic MILF that loves anal sex. The booty blessed dirty blonde teases and poses, eagerly showing off her plump rump. She strips off her blue bra to reveal her big tits she peels off her matching panties to softly caress her pussy. Vickie soon finds herself seated on the couch and making out with porn pro Mark Wood. She gives him a passionate blowjob. Mark bends her over and bangs her box. Next, he slides his shaft into her sphincter. Ivy's breasts bounce as Mark slam-fucks her asshole. She whimpers and masturbates throughout a crazy butthole reaming. This scalding, kinky backdoor session serves up rowdy rod riding, rude rectal gaping and flavorful ass-to-mouth fellatio. A throat-fucking finale climaxes with a creamy cum facial. Satisfied Ivy swallows a helping of hot sperm.
RapidgatorK2S

Evil Angel - Ivy Ireland - Sultry Backdoor Milf

File: yympnnaevanivyireyyvqpkscel.mp4
Size: 2.80 GB
Duration: 50:09
Resolution: 1920x1080
Format: mp4
Description: Stylish MILF Ivy Ireland performs a hot striptease. In skimpy lingerie with clear heels and a choker, the insatiable brunette caresses her trim body while swaying to the music, spreading her butt cheeks and flaunting her perky titties. Director-performer Mark Wood takes a seat on the couch in front of her, jerking his joint until Ivy heads over to help. She immediately feasts on his thick prick, drooling and choking through a sloppy blowjob.

Action accelerates Ivy bends over, giving Mark easy access to stuff his schlong into her slit. Intense pussy pounding leads to heated anal sex, with Ivy masturbating her clit while Mark clobbers her colon. The heated hotel romp delivers rectal gaping and ass-to-mouth throat fucking. Dirty-talking Ivy lewdly rims Mark's bunghole, soon straddling him for more sodomy. The porn stud finishes Ivy off with a cum facial. Ivy plays with her reward, swishing the sperm over her lips and swallowing.
RapidgatorK2S

Evil Angel - Savvy Suxx - Blowjob & Rim Job 4-Way

File: zpryinaevansavsuxsavkxg1m1y.mp4
Size: 1.75 GB
Duration: 28:53
Resolution: 1920x1080
Format: mp4
Description: Beautiful Savvy Suxx's blonde-streaked hair frames her pretty face. She fondles her appealing anatomy in a sexy tease. Savvy kneels before a trio of studs sporting stiff pricks, Milan, Donny Sins and Nade Nasty. She gives well-hung Milan a blowjob, and she sucks his nuts, soaking them with spit. Savvy gobbles Donny Sins' balls next, filling her mouth. Nade 'teabags' her hot lips with his dangling ball bag! Surging schlongs surround the heart stopping hottie, who strokes two at a time while inhaling the third. Savvy's virtuosic fellatio creates a flood of slobber. The dirty girl squeezes Donny's scrotum till it turns purple as she rims his rectum! She tongues Nade's bunghole passionately. Savvy feverishly feeds on the parade of pricks as strands of saliva spill down her torso. This decadent oral foursome builds to a foamy climax, with each boner pumping out a spunky load. Glazed with a cum facial, Savvy lets the jism spill from her chin and onto her natural tits. She smears the mess into her cheeks like lotion.
RapidgatorK2S

Evil Angel - Francesca Le & Cassidy Luxe - Miami Threesome

File: ytas7naevanfracas5iepnz7wek.mp4
Size: 2.50 GB
Duration: 43:52
Resolution: 1920x1080
Format: mp4
Description: Roaming the streets of Miami, pornographer Mark Wood finds busty, married MILFs Cassidy Luxe and Francesca Le in their workout gear. They lead him to their posh, oceanfront hotel room. Looking to get their freak on, the ladies don skimpy swimsuits that show their big boobs and hot butts. Francesca and Cassidy give Mark a messy double blowjob, drooling as they worship his thick, club-like cock. Blonde, tattooed Cassidy slurps shaft while tan Francesca rims bunghole, with breaks for lesbian kissing and making out. Mark fucks Cassidy's pussy, and then Francesca hops on his lap for hot sodomy. The intense backdoor threesome features sloppy, ass-to-mouth fellatio and rectal gaping. Mark treats both babes to hard backdoor drilling. In a kinky climax, Mark rewards Cassidy with a creamy cum facial, and then Francesca slurps up the semen, swallowing some and sharing a tasty kiss with Cassidy.
RapidgatorK2S

Evil Angel - Ivy Maddox & Nicole Black - 6 On 2 DAP Gangbang

File: 1c4rcnaevanivynicbngyt9seob.mp4
Size: 3.48 GB
Duration: 51:01
Resolution: 1920x1080
Format: mp4
Description: Buxom dirty blonde Ivy Maddox and longhaired, slender-legged Nicole Black take on six big cocks in an anal orgy! Cute in miniskirts, fishnets and heels, they stimulate nipples, share lesbian kissing and masturbate. Brian Ragnastone, Deny Lou, Mark Dozer, Neeo, Thomas and Thomas Lee surround Nicole and Ivy both groaning, squealing girls take boners straight-to-anal while stroke-sucking the remaining rods. The guys flip the ladies onto hands and knees for side-by-side, doggie-style sodomy. As the men switch off, the girls repeatedly display gaping sphincters. Nicole straddles Ivy for French kissing while thick pricks plug assholes and mouths. Two dicks cram tan-skinned Nicole's bunghole she gives a blowjob during that double-anal penetration! In her British accent, Ivy talks dirty about ass-to-mouth flavor, and she sucks two shafts fresh from Nicole's wide-open rectum! The DAP train rolls over Ivy next, with Nicole blowing two rectally seasoned schlongs. This rough clusterfuck brings more DAP manhandling in multiple positions, plus choking, hair pulling, spanking and rimming. The girls' faces reveal the intensity. Ivy's anus gapes, showing pink flesh, while Nicole's bunghole is a massive, dark cavern. After every guy cums, Nicole and Ivy drool a mass of semen mouth-to-mouth, and they swallow!
RapidgatorK2S

Evil Angel - Vicki Chase - Slobber-Soaked Bj 3-way

File: uked8naevanvicchaaykykk37qz.mp4
Size: 1.13 GB
Duration: 22:20
Resolution: 1920x1080
Format: mp4
Description: Ravishing Vicki Chase teases to a thudding synth beat in bright pink gear with stockings and heels to match. Ready for an oral threesome, studs Chocolate God and Donny Sins flank the slinky brunette diva. She tugs on Chocolate God's big Black cock while she slobbers on Donny Sins's balls. Pretty Vicki gives Chocolate God a spit-dripping blowjob. She makes out with his scrotum! And she sucks Donny Sins's long dick with greedy oral lust. The two dudes stand above Vicki, feeding their dicks to her she slobbers on their dangling nut sacks and bathes their boners with her slick saliva. Vicki shows her deepthroat skill. She spits on their testicles and guzzles up the slop! And she stuffs both bulging penis heads in her mouth! Donny Sins blasts copious semen across her forehead, and it cascades down her cheeks. Chocolate God spills his gooey load on her kisser. Vicki laps up the leftover spunk, coated in a glistening cum facial.
RapidgatorK2S

Evil Angel - Sheena Shaw & Rebel Rhyder - Freaky Anal Threesome

File: nzfnwnaevansherebzkuwxjfiyn.mp4
Size: 1.98 GB
Duration: 40:24
Resolution: 1920x1080
Format: mp4
Description: Comely anal queens Sheena Shaw and Rebel Rhyder take on super-hung Richard Mann in a kinky sodomy spectacle. Tan, hot-assed Sheena and ivory-skinned, voluptuous Rebel tease in sheer bikini lingerie and heels. Dirty talk spices the entire scene, both girls encouraging nasty behavior and filthy-minded Sheena addressing viewers directly. A giant, black dildo opens Sheena and Rebel's assholes. Sheena licks Rebel's widely gaping anus. Each lady's rear anatomy prolapses, producing a huge, pink rosebud for the other to lap! Sheena's butthole engulfs Richard's big Black cock her pretty booty snaps and twerks through a slobber-lubed buttfuck ride. Rebel gives Richard an ass-to-mouth blowjob. Squealing Sheena fists her own rectum! Rebel alternates A2M fellatio with lesbian rimming and rosebud tonguing. Next, Rebel slams her tush onto Richard's rod. Sheena spits on pussy and pumping prick. She pulls Richard's boner from Rebel's bunghole for A2M head. Rebel's hands stretch her gape to maximum diameter, and pink innards pop out. Richard throat-fucks Rebel, with gobs of drool flowing into a funnel planted in Sheena's sphincter, and Sheena farts the slop out graphically! A POV shot captures Sheena's cum facial. The girls swap oozing wads of semen mouth-to-mouth. Richard places jeweled tiaras on their heads!
RapidgatorK2S

Evil Angel - Elana Bunnz - Elana & Richard

File: dhbvonaevanelabunpgrejtwgbv.mp4
Size: 1.47 GB
Duration: 32:34
Resolution: 1920x1080
Format: mp4
Description: Blonde Elana Bunnz is the nurse responsible for the care of director-performer Richard Mann. When the sneaky babe discovers Richard's laptop on his dresser, she snoops to see what she can find. Elana is stunned when she stumbles across a video of Richard roughly fucking a young girl! Thinking that he's slumbering, aroused Elana masturbates, but Richard watches clandestinely and jacks his big Black cock. He sneaks up on her, his massive boner exposed, and that's enough to captivate Elana!

She drops to her knees to give a sloppy, choking blowjob, lapping Richard's balls. Elana straddles him for a ride, moaning as Richard ruthlessly slams her slit. The wild woman pulls his thick prick form her pussy, trembling in lust as she ejaculates girl squirt! Dominant Richard drills his nurse intensely, and orgasmic Elana blasts multiple, sloppy geysers of juice. She shoves his shaft in her mouth to taste her sweet girl cum. Finally, Elana strokes Richard's rod to an explosive, sperm-gushing climax.
RapidgatorK2S

Evil Angel - Summer Vixen - Anal Whore, Pussy Squirt

File: 9plp2naevansumvixw627a4pciu.mp4
Size: 1.71 GB
Duration: 39:53
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde star Summer Vixen dances and teases in schoolgirl attire plaid miniskirt, virginal white top with fishnet stockings and heels. She fondles her natural tits and rubs her pussy through thin fabric. The smiling hottie shares dirty stories with the pro fuckerco-director Mick Blue. He massages lotion into her breasts. She flexes and spreads her crinkly anus for Mick's POV cam. Summer pins back her legs to masturbate. Mick shoves a dildo into her sphincter as Summer coos gleefully. She ejaculates torrents of squirt! Mick thrusts his big cock up her ass. 'I'm such an anal whore!' declares Summer. Mick buttfucks her and jams the phallus into her gash for a dickdildo DP. The talkative tart lays on the dirty talk as he drills her holes. Summer gives an ass-to-mouth blowjob, and she rims Mick's sphincter. Mick fucks her pussy doggie-style. Finally, he cums on her tongue. Summer swallows the semen, fully satisfied.
RapidgatorK2S

Evil Angel - Francesca Le & Alexis James - Anal 3-way

File: ehzvanaevanfraalendxvkgbxhw.mp4
Size: 1.73 GB
Duration: 40:21
Resolution: 1920x1080
Format: mp4
Description: Trim, sexy hottie Alexis James teases in skimpy swimwear. The spunky tart flaunts perky tits, spreads her sweet slit, shakes her booty and shows off her open sphincter. Swinging hotwife Francesca Le welcomes the young cutie with kissing and groping. The busty MILF eats and rims Alexis, warming her up for a threesome. Francesca's husband, Mark Wood, arrives to provide the meat. Alexis gives the married stud a spit-soaked blowjob, sliding her tongue under his shaft as he fucks her throat. Lewd Alexis eats his asshole! She spreads her legs on the bed, whimpering when Mark's hard-on enters her pussy. Things ramp up when Mark's meat drills into her rectum. Francesca films the intense sodomy session, taking breaks at various points to jump into the fun. The camera captures multiple close-up views of Alexis' immensely gaping anus. Both babes enjoy vigorous anal reaming. The freaky encounter includes graphic, ass-to-mouth cocksucking and hard-riding sodomy. Alexis takes a massive cum facial.
RapidgatorK2S

Evil Angel - Natalie Brooks - Rim Job, Bj & Fuck Fun

File: bp2nunaevannatbroeshbtbeoha.mp4
Size: 1.73 GB
Duration: 40:18
Resolution: 1920x1080
Format: mp4
Description: Hot, leggy babe Natalie Brooks stuns in plaid schoolgirl miniskirt and soft, white blouse with matching stockings. She pulls up the uniform to show off her black, studded panties. The dark-haired, dark-eyed doll teases slowly, flaunting her delectable butt. She uncovers her chest, revealing natural tits. Natalie exchanges some friendly repartee with performerco-director Mick Blue as his intimate camera work puts her scrumptious body practically in the viewer's face. She masturbates for the pervy filmmaker and the audience. Mick eats her juicy pussy. He drives his big cock deeply into her slit while she breathlessly rubs her clit. Natalie takes a fuck ride. Mick captures a blowjob in POV-style footage. Nasty Natalie rims his asshole. They hump and pump in a variety of positions. Mick pummels her poon till he busts his load, filling her snatch with a creampie. Spunk drizzles from blissful Natalie's gooey gash.
RapidgatorK2S

Evil Angel - Stephanie Love - Curvy Girl's Creampie

File: krlnlnaevanstelov5vnbhxq8wx.mp4
Size: 1.71 GB
Duration: 39:49
Resolution: 1920x1080
Format: mp4
Description: Voluptuous, longhaired blonde Stephanie Love grooves through a slow tease in a white top and a plaid, pleated schoolgirl mini skirt. She flaunts her shapely, uncovered ass and reveals her big tits. Stephanie shares a brief chat with top performerdirector Mick Blue. The sultry-voiced vixen tells some dirty stories from her past. Mick's camera takes in her delectable anatomy as she exposes her bald slit. Stephanie masturbates her snatch, and then Mick feverishly fucks her! Stephanie wraps her lush, sensuous lips around Mick's big cock as he shoots the rousing blowjob from a POV angle that puts viewers practically in the scene. She shoves her tongue up his ass for a gnarly rim job. Mick slides his schlong into her pussy and bones her doggie-style. Orgasmic Stephanie wails as Mick pummels her wet slot in multiple positions. He busts his nut in her hot box. Stephanie lets Mick's creampie trickle out of her fully fucked twat.
RapidgatorK2S

Evil Angel - Francesca Le - Swing Debauchery Desired

File: vm14inaevanfralexesrsbedq5.mp4
Size: 1.32 GB
Duration: 30:39
Resolution: 1920x1080
Format: mp4
Description: Beautiful, oversexed MILF Francesca Le is always checking a swinger website for new, hung guys. The busty adventuress recently met a new stud on the smutty site his handle is 'Debauchery Desired,' and now they're hooking up for a freaky flesh meet! Dolled up in white lingerie, Francesca talks dirty to her new conquest, and they make out. The stud spanks her plump booty as she grinds on his lap. Francesca unbuttons his pants to unleash his massive meat. She gives a sloppy blowjob, choking and drooling over his big cock. Next, Debauchery Desired penetrates her pussy, pounding Francesca as her jumbo jugs bounce. The heated, gash-bashing encounter delivers rod riding and throat reaming fellatio. Lewd Francesca can't resist rimming her new man's bunghole. For the finale, Mr. DD jacks his joint and slathers Francesca with an epic cum facial.
RapidgatorK2S

Evil Angel - Francesca Le - Hotwife Cuckolds You

File: vr2z1naevanfralexd6adnmg6c.mp4
Size: 1.43 GB
Duration: 29:50
Resolution: 1920x1080
Format: mp4
Description: Fabulous, busty MILF Francesca Le loves kinky sex. The dirty-minded pornographer treats fans to a special experience In POV-style footage, you get to see what it'd be like to be gorgeous hotwife Francesca's cuckold! Tempting in a tight skirt, skimpy top and heels, she explains the dirty doings about to go down. Francesca strips and teases you with hot, dominant jerk-off encouragement. She soon welcomes stud Brock Cooper into the marital bed. The horny wife unbuttons his pants and whips out his massive boner for a choking, drooling blowjob. Brock slides his big cock into Francesca's pussy while she masturbates her clit he slam-fucks the wild woman as she moans in ecstasy. The epic affair includes loads of explicit dirty talk a spit-soaked titty fuck and rod-riding copulation. Nasty Francesca rims Brock's bunghole and worships his meat. He sprays his sperm over her wet slit. Francesca spreads open her semen-soaked pussy ... and orders her cuck YOU! to slurp up the mess!
RapidgatorK2S

Evil Angel - Ivy Ireland - Anal, A2m & Rim Job Study

File: l9dzwnaevanivyireakks7y91he.mp4
Size: 1.90 GB
Duration: 39:54
Resolution: 1920x1080
Format: mp4
Description: Hot-bodied Ivy Ireland teases enchantingly in her sexy schoolgirl uniform white blouse and stockings, plaid mini skirt and black heels. Ivy displays her round ass, unknots her top and shows off her small, natural tits. The heavenly brunette engages in a pre-scene chat with top pornographer Mick Blue. She masturbates with building intensity as Mick shoots intimate, POV-style footage. He slides a mammoth dildo up Ivy's rear chute, loosening the hottie's butthole for anal fucking. She massages her clit while Mick's big cock invades her rectum. Ivy gives him an ass-to-mouth blowjob, and she rims Mick, eating his sphincter. He fucks her pussy doggie-style amid an all-holes workout. The aroused, tasty beauty plays in multiple positions. This session climaxes with Mick stroking a copious load of spunk onto Ivy's tongue. 'Thank you for using my holes,' she says with a wide smile as pearly cream drips from her chin.
RapidgatorK2S

Evil Angel - Francesca Le - Buttfucked By An Agent

File: zmkpsnaevanfralebu4zxjo7nq.mp4
Size: 2.46 GB
Duration: 38:12
Resolution: 1920x1080
Format: mp4
Description: Nasty porn director and spectacular MILF performer Francesca Le stuns in a tight, revealing outfit, eagerly waiting for her female co-star to arrive till young talent agent Conor Coxxx informs her that the girl can't be found. But frustrated Francesca needs sex! Conor volunteers to service the horny lady, and she can't resist. They make out, Francesca stroking his dick through his jeans. She yanks off his pants to give a slobbering blowjob.

Francesca hops onto his lap and slides his big cock between her plump butt cheeks. She whimpers when Conor stuffs his boner into her pussy. Francesca rides rod and talks dirty through an epic affair. The action escalates to intense anal reaming with sloppy, ass-to-mouth fellatio lewd rectal gaping and a creamy cum facial. Francesca uses Conor's prick to scoop excess semen from her face, swallowing the juice. She confessing to Conor, 'You're the best agent ever!'
RapidgatorK2S

Evil Angel - Scarlet Chase - Tight Squeeze Gets Double Dipped

File: m6saanaevanscachaelapqfagtl.mp4
Size: 1.74 GB
Duration: 28:12
Resolution: 1920x1080
Format: mp4
Description: This scene premieres exclusively on EvilAngel.com! Athletic beauty Scarlet Chase stuns in a revealing fishnet outfit, shaking her plump booty through a hot opening tease. The busty goddess strips off the few threads she's wearing. Anticipating intense sodomy, she fondles her pussy and crams anal beads into her butthole. Scarlet greets Elic Chase with a drooling blowjob. The insatiable vixen continues to masturbate while taking brief breaks to suck Elic's meat pole. Scarlet soon finds herself bent over on the couch, eager for intensified 'full-fill-ment.' With a sex toy stuffing her sphincter, Elic fucks her twat. Then he buttfucks Scarlet while the toy is still inside her rectum, a dickdildo double-anal stuffing! She rides Elic's rod and enjoys a serious backdoor bang, pausing at points to give slobbering, ass-to-mouth head. Freaky, no-holes-barred action includes nasty farting and a creamy climax Scarlet slurps Elic's dick until he ejaculates into her mouth, savoring his milky sperm and swallowing it down!
RapidgatorK2S

Evil Angel - Francesca Le - Wife Swings For Big Cock

File: blyoynaevanfraleaizx7pwkcn.mp4
Size: 1.46 GB
Duration: 33:03
Resolution: 1920x1080
Format: mp4
Description: Married pornographers Francesca Le and Mark Wood are very active in the swinging community. In this scene, Mark films his busty hotwife with young, hung stud Parker Ambrose. The tan MILF can barely contain herself in the opening moments, grabbing his big cock through his jeans while they passionately make out. Francesca unleashes his massive meat from his pants and gives him a nasty, worshipful blowjob with ball lapping. She talks dirty whenever his thick prick pulls out of her mouth, and she moans when he stuffs his boner into her pussy. Francesca spanks her plump booty while feverishly riding dick, begging Parker to pound her harder throughout. The freaky, extramarital session includes a slippery titty fuck slit-slamming copulation and an orgasmic climax Parker blasts a cum facial over Francesca's open mouth she scoops up excess semen and swallows it down!
RapidgatorK2S