pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Page#
21

Evil Angel - Rebecca Volpetti & Veronica Leal - Office Anal 3-Way

File: snunhnaevanrebverc9zivjmlfg.mp4
Size: 1.84 GB
Duration: 42:59
Resolution: 1920x1080
Format: mp4
Description: Sexy real estate agent Veronica Leal chats with associate Darrell Deeps, eager for a lunch date with girlfriend Rebecca Volpetti. The girls ask Darrell to join them, but much to their surprise, he declines, opting to relax at the office. As he dozes off, the beautiful babes appear in a vision... Wearing matching lingerie, they share a kinky lesbian tryst, eating pussy and rimming ass. Darrell enjoys the show as the girls passionately kiss and caress one another. Veronica and Rebecca crawl to Darrell to worship his big Black cock. They give a nasty double blowjob. Next, Darrell bangs them on the bed. He pounds Rebecca's cunt while she eats Veronica, and the girls take turns with his dick. Intense slit slamming leads to furious anal sex, Veronica whimpering as she rides rod. Both babes give drooling, ass-to-mouth fellatio, and in a messy climax, they swap semen orally and swallow it! This erotic threesome includes freaky foot fetish.

Evil Angel - Miss Raquel - Kneeling Bj, Messy Facial

File: 2wrkgnaevanmisraqeoffppnt6q.mp4
Size: 872.66 MB
Duration: 19:58
Resolution: 1920x1080
Format: mp4
Description: Busty MILF Miss Raquel seems to have cock on the brain. The thickly curvaceous fellatrix teams up with porn pro Mark Wood for a nasty oral session. First comes a twerking tease sequence -- wearing lingerie, Miss Raquel shakes her plump caboose for the camera. She strips and caresses her tantalizing body. When Mark enters the frame, Miss Raquel immediately drops to her knees. Mark stuffs his meat into her mouth and reams her throat, with Raquel obediently lapping his balls and worshiping his boner. The deviant dude grips her hair for leverage, slam-fucking Raquel's gullet through a raunchy blowjob. Messy fucking fellatio climaxes with a creamy cum facial. Sperm drips from Miss Raquel's mouth. 'So fucking amazing!' says the impressed vixen.

Evil Angel - Chanel Camryn - Hot Testicle Tongue Bath

File: 2tkmdnaevanchacamxtfrvarnkq.mp4
Size: 1.36 GB
Duration: 31:48
Resolution: 1920x1080
Format: mp4
Description: Petite, cute brunette Chanel Camryn teases, peeling off her dainty, lace lingerie for director Jonni Darkko's skilled camera. She worships muscular stud Milan's cock and balls. Camryn slobbers gobs of spit onto Milan's nut sack as she strokes his tool. And the nasty girl rims his asshole. Jonni joins the fun -- his lens captures the action as she gives his testicles a swirling tongue bath! Camryn strokes both erect pricks and stuffs her mouth with scrotums.

She trades their boners back and forth, giving messy blowjobs and feeding on their hanging bags. The slobber-soaked BJ threesome intensifies as thick saliva coats Camryn's pretty face! Her relentless fellatio brings things to a wet climax The guys drench Camryn in sloppy cum facials. The cocksucking and nut licking conclude as Camryn performs a dual BJ clean-off, licking up surplus semen.

Evil Angel - Francesca Le - Big-Cock Anal Affair

File: c28xfnaevanfrale7hzpo3t72c.mp4
Size: 1.53 GB
Duration: 35:42
Resolution: 1920x1080
Format: mp4
Description: Freaky MILF Francesca Le's husband is away on business, so the buxom stunner meets young stud Parker Ambrose in a ritzy hotel room for a kinky anal affair. They make out, kissing and caressing to initiate their afternoon tryst. Francesca pulls out his seriously big cock and treats him to a slobbering blowjob, choking and lapping his balls. She sits on his lap, slowly stuffing his humongous erection into her hungry pussy.

Francesca rides his rod, and she tastes her juice on his jumbo slab of wet meat. She whimpers when Parker pounds his pud into her anus. The horny couple enjoys intense backdoor boning, with Francesca pausing to give drooling, ass-to-mouth fellatio. The cheating lovers get extra kinky with rectal gaping and spanking. Parker splashes Francesca with a cum facial. Splooge drips down her cheeks, and she uses Parker's prick to scoop up semen and swallow it down!

Evil Angel - Chloe Amour - Sloppy Bj & Ball Lapping

File: fgqulnaevanchlamo41hi5r3ina.mp4
Size: 1.51 GB
Duration: 35:14
Resolution: 1920x1080
Format: mp4
Description: Breathtaking brunette Chloe Amour dazzles in violet lingerie. The tantalizing babe teases, writhing on a white couch. She takes on lucky studs Donny Sins and Milan plus director Jonni Darkko in a nasty oral foursome. The scintillating siren gives Donny a blowjob. She sucks on Milan's scrotum, spit sluicing from his nuts. Chloe laps Jonni's testicles. She feeds on a buffet of boners and balls, gluttonously stuffing her mouth.

Exhibitionistic, pervy Chloe salivates through frenzied fellatio. She plays with her bouncy boobs as she spit-polishes pricks. The guys take turns fucking her mouth as gobs of slobber overflow onto her chin and down her torso! The action climaxes as she strokes the three rods till they spew! Jonni splashes her forehead with a hot load. Donny and Milan bathe our heroine in glorious cum facials.

Evil Angel - Sadie Summers - Bjs, Balls & Rim Service

File: gw7xanaevansadsum4nbkuoyo1q.mp4
Size: 1.09 GB
Duration: 25:29
Resolution: 1920x1080
Format: mp4
Description: Knockout blonde MILF Sadie Summers tempts in pink bikini lingerie and white heels. The vixen teases stylish director Jonni Darkko's camera. She drops her top to show off her big tits. 'I wanna worship a whole bunch of hot balls with my mouth,' says dirty-talking Sadie. She licks muscular Milan's scrotum and strokes his boner. Sadie gives stud Donny Sins a raunchy blowjob. The lady takes Dwayne Foxxx's big Black cock in her sultry mouth. Head jobs come with a cleavage-cramming titty fuck. Sadie smiles as she gives each meaty pole her intimate attention. She spit-shines Milan's asshole with a freaky rim job. Next, she worships Dwayne's nut sack and tongues his bunghole! Rounds of oral worship culminate in a creamy climax The guys jerk their joints till they soak horny Sadie with a fantastic cum facial flourish!

Evil Angel - Arabelle Raphael - Ball-Licking Blowbang

File: pnxsinaevanararaprpejmozmsu.mp4
Size: 1.71 GB
Duration: 39:51
Resolution: 1920x1080
Format: mp4
Description: Voluptuous oral artist Arabelle Raphael flaunts her heavily tattooed bod in a Leopard print bikini, and she lets her mammoth, natural jugs flop out. Five dudes surround the lush-lipped bombshell, stroking their boners, ready for a lewd blowbang! Arabelle sucks Chocolate God's ball sack. She gives Milan a blowjob while the other guys grope and feel her. Arabelle worships Donny Sins and Apollo Banks' scrotums. She deepthroats meat poles in a frenzy of perversity!

Strands of spit spill out onto her pendulous melons. Arabelle wraps her slobber-lubed big boobs around a dick for a rapid, slick titty fuck! The insatiable lady laps sweaty balls with skill and lust. Director Jonni Darkko joins the decadent fun, shooting POV-style footage as insatiable Arabelle gives him head. She dribbles long strands of saliva as she feeds on every cock. In a spectacular climax, the guys splatter Arabelle with a sticky tsunami of cum facials!

Evil Angel - Sweet Vicky - Dirty Blonde Booty Hottie

File: tkjwsnaevanswevic58nzki67wx.mp4
Size: 1.75 GB
Duration: 40:45
Resolution: 1920x1080
Format: mp4
Description: Sweet Vickie is a busty, athletic MILF that loves anal sex. The booty blessed dirty blonde teases and poses, eagerly showing off her plump rump. She strips off her blue bra to reveal her big tits she peels off her matching panties to softly caress her pussy. Vickie soon finds herself seated on the couch and making out with porn pro Mark Wood. She gives him a passionate blowjob. Mark bends her over and bangs her box. Next, he slides his shaft into her sphincter. Ivy's breasts bounce as Mark slam-fucks her asshole. She whimpers and masturbates throughout a crazy butthole reaming. This scalding, kinky backdoor session serves up rowdy rod riding, rude rectal gaping and flavorful ass-to-mouth fellatio. A throat-fucking finale climaxes with a creamy cum facial. Satisfied Ivy swallows a helping of hot sperm.

Evil Angel - Ivy Ireland - Sultry Backdoor Milf

File: yympnnaevanivyireyyvqpkscel.mp4
Size: 2.80 GB
Duration: 50:09
Resolution: 1920x1080
Format: mp4
Description: Stylish MILF Ivy Ireland performs a hot striptease. In skimpy lingerie with clear heels and a choker, the insatiable brunette caresses her trim body while swaying to the music, spreading her butt cheeks and flaunting her perky titties. Director-performer Mark Wood takes a seat on the couch in front of her, jerking his joint until Ivy heads over to help. She immediately feasts on his thick prick, drooling and choking through a sloppy blowjob.

Action accelerates Ivy bends over, giving Mark easy access to stuff his schlong into her slit. Intense pussy pounding leads to heated anal sex, with Ivy masturbating her clit while Mark clobbers her colon. The heated hotel romp delivers rectal gaping and ass-to-mouth throat fucking. Dirty-talking Ivy lewdly rims Mark's bunghole, soon straddling him for more sodomy. The porn stud finishes Ivy off with a cum facial. Ivy plays with her reward, swishing the sperm over her lips and swallowing.

Evil Angel - Savvy Suxx - Blowjob & Rim Job 4-Way

File: zpryinaevansavsuxsavkxg1m1y.mp4
Size: 1.75 GB
Duration: 28:53
Resolution: 1920x1080
Format: mp4
Description: Beautiful Savvy Suxx's blonde-streaked hair frames her pretty face. She fondles her appealing anatomy in a sexy tease. Savvy kneels before a trio of studs sporting stiff pricks, Milan, Donny Sins and Nade Nasty. She gives well-hung Milan a blowjob, and she sucks his nuts, soaking them with spit. Savvy gobbles Donny Sins' balls next, filling her mouth. Nade 'teabags' her hot lips with his dangling ball bag! Surging schlongs surround the heart stopping hottie, who strokes two at a time while inhaling the third. Savvy's virtuosic fellatio creates a flood of slobber. The dirty girl squeezes Donny's scrotum till it turns purple as she rims his rectum! She tongues Nade's bunghole passionately. Savvy feverishly feeds on the parade of pricks as strands of saliva spill down her torso. This decadent oral foursome builds to a foamy climax, with each boner pumping out a spunky load. Glazed with a cum facial, Savvy lets the jism spill from her chin and onto her natural tits. She smears the mess into her cheeks like lotion.

Evil Angel - Francesca Le & Cassidy Luxe - Miami Threesome

File: ytas7naevanfracas5iepnz7wek.mp4
Size: 2.50 GB
Duration: 43:52
Resolution: 1920x1080
Format: mp4
Description: Roaming the streets of Miami, pornographer Mark Wood finds busty, married MILFs Cassidy Luxe and Francesca Le in their workout gear. They lead him to their posh, oceanfront hotel room. Looking to get their freak on, the ladies don skimpy swimsuits that show their big boobs and hot butts. Francesca and Cassidy give Mark a messy double blowjob, drooling as they worship his thick, club-like cock. Blonde, tattooed Cassidy slurps shaft while tan Francesca rims bunghole, with breaks for lesbian kissing and making out. Mark fucks Cassidy's pussy, and then Francesca hops on his lap for hot sodomy. The intense backdoor threesome features sloppy, ass-to-mouth fellatio and rectal gaping. Mark treats both babes to hard backdoor drilling. In a kinky climax, Mark rewards Cassidy with a creamy cum facial, and then Francesca slurps up the semen, swallowing some and sharing a tasty kiss with Cassidy.

Evil Angel - Ivy Maddox & Nicole Black - 6 On 2 DAP Gangbang

File: 1c4rcnaevanivynicbngyt9seob.mp4
Size: 3.48 GB
Duration: 51:01
Resolution: 1920x1080
Format: mp4
Description: Buxom dirty blonde Ivy Maddox and longhaired, slender-legged Nicole Black take on six big cocks in an anal orgy! Cute in miniskirts, fishnets and heels, they stimulate nipples, share lesbian kissing and masturbate. Brian Ragnastone, Deny Lou, Mark Dozer, Neeo, Thomas and Thomas Lee surround Nicole and Ivy both groaning, squealing girls take boners straight-to-anal while stroke-sucking the remaining rods. The guys flip the ladies onto hands and knees for side-by-side, doggie-style sodomy. As the men switch off, the girls repeatedly display gaping sphincters. Nicole straddles Ivy for French kissing while thick pricks plug assholes and mouths. Two dicks cram tan-skinned Nicole's bunghole she gives a blowjob during that double-anal penetration! In her British accent, Ivy talks dirty about ass-to-mouth flavor, and she sucks two shafts fresh from Nicole's wide-open rectum! The DAP train rolls over Ivy next, with Nicole blowing two rectally seasoned schlongs. This rough clusterfuck brings more DAP manhandling in multiple positions, plus choking, hair pulling, spanking and rimming. The girls' faces reveal the intensity. Ivy's anus gapes, showing pink flesh, while Nicole's bunghole is a massive, dark cavern. After every guy cums, Nicole and Ivy drool a mass of semen mouth-to-mouth, and they swallow!

Evil Angel - Vicki Chase - Slobber-Soaked Bj 3-way

File: uked8naevanvicchaaykykk37qz.mp4
Size: 1.13 GB
Duration: 22:20
Resolution: 1920x1080
Format: mp4
Description: Ravishing Vicki Chase teases to a thudding synth beat in bright pink gear with stockings and heels to match. Ready for an oral threesome, studs Chocolate God and Donny Sins flank the slinky brunette diva. She tugs on Chocolate God's big Black cock while she slobbers on Donny Sins's balls. Pretty Vicki gives Chocolate God a spit-dripping blowjob. She makes out with his scrotum! And she sucks Donny Sins's long dick with greedy oral lust. The two dudes stand above Vicki, feeding their dicks to her she slobbers on their dangling nut sacks and bathes their boners with her slick saliva. Vicki shows her deepthroat skill. She spits on their testicles and guzzles up the slop! And she stuffs both bulging penis heads in her mouth! Donny Sins blasts copious semen across her forehead, and it cascades down her cheeks. Chocolate God spills his gooey load on her kisser. Vicki laps up the leftover spunk, coated in a glistening cum facial.

Evil Angel - Sheena Shaw & Rebel Rhyder - Freaky Anal Threesome

File: nzfnwnaevansherebzkuwxjfiyn.mp4
Size: 1.98 GB
Duration: 40:24
Resolution: 1920x1080
Format: mp4
Description: Comely anal queens Sheena Shaw and Rebel Rhyder take on super-hung Richard Mann in a kinky sodomy spectacle. Tan, hot-assed Sheena and ivory-skinned, voluptuous Rebel tease in sheer bikini lingerie and heels. Dirty talk spices the entire scene, both girls encouraging nasty behavior and filthy-minded Sheena addressing viewers directly. A giant, black dildo opens Sheena and Rebel's assholes. Sheena licks Rebel's widely gaping anus. Each lady's rear anatomy prolapses, producing a huge, pink rosebud for the other to lap! Sheena's butthole engulfs Richard's big Black cock her pretty booty snaps and twerks through a slobber-lubed buttfuck ride. Rebel gives Richard an ass-to-mouth blowjob. Squealing Sheena fists her own rectum! Rebel alternates A2M fellatio with lesbian rimming and rosebud tonguing. Next, Rebel slams her tush onto Richard's rod. Sheena spits on pussy and pumping prick. She pulls Richard's boner from Rebel's bunghole for A2M head. Rebel's hands stretch her gape to maximum diameter, and pink innards pop out. Richard throat-fucks Rebel, with gobs of drool flowing into a funnel planted in Sheena's sphincter, and Sheena farts the slop out graphically! A POV shot captures Sheena's cum facial. The girls swap oozing wads of semen mouth-to-mouth. Richard places jeweled tiaras on their heads!

Evil Angel - Elana Bunnz - Elana & Richard

File: dhbvonaevanelabunpgrejtwgbv.mp4
Size: 1.47 GB
Duration: 32:34
Resolution: 1920x1080
Format: mp4
Description: Blonde Elana Bunnz is the nurse responsible for the care of director-performer Richard Mann. When the sneaky babe discovers Richard's laptop on his dresser, she snoops to see what she can find. Elana is stunned when she stumbles across a video of Richard roughly fucking a young girl! Thinking that he's slumbering, aroused Elana masturbates, but Richard watches clandestinely and jacks his big Black cock. He sneaks up on her, his massive boner exposed, and that's enough to captivate Elana!

She drops to her knees to give a sloppy, choking blowjob, lapping Richard's balls. Elana straddles him for a ride, moaning as Richard ruthlessly slams her slit. The wild woman pulls his thick prick form her pussy, trembling in lust as she ejaculates girl squirt! Dominant Richard drills his nurse intensely, and orgasmic Elana blasts multiple, sloppy geysers of juice. She shoves his shaft in her mouth to taste her sweet girl cum. Finally, Elana strokes Richard's rod to an explosive, sperm-gushing climax.

Evil Angel - Summer Vixen - Anal Whore, Pussy Squirt

File: 9plp2naevansumvixw627a4pciu.mp4
Size: 1.71 GB
Duration: 39:53
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde star Summer Vixen dances and teases in schoolgirl attire plaid miniskirt, virginal white top with fishnet stockings and heels. She fondles her natural tits and rubs her pussy through thin fabric. The smiling hottie shares dirty stories with the pro fuckerco-director Mick Blue. He massages lotion into her breasts. She flexes and spreads her crinkly anus for Mick's POV cam. Summer pins back her legs to masturbate. Mick shoves a dildo into her sphincter as Summer coos gleefully. She ejaculates torrents of squirt! Mick thrusts his big cock up her ass. 'I'm such an anal whore!' declares Summer. Mick buttfucks her and jams the phallus into her gash for a dickdildo DP. The talkative tart lays on the dirty talk as he drills her holes. Summer gives an ass-to-mouth blowjob, and she rims Mick's sphincter. Mick fucks her pussy doggie-style. Finally, he cums on her tongue. Summer swallows the semen, fully satisfied.

Evil Angel - Francesca Le & Alexis James - Anal 3-way

File: ehzvanaevanfraalendxvkgbxhw.mp4
Size: 1.73 GB
Duration: 40:21
Resolution: 1920x1080
Format: mp4
Description: Trim, sexy hottie Alexis James teases in skimpy swimwear. The spunky tart flaunts perky tits, spreads her sweet slit, shakes her booty and shows off her open sphincter. Swinging hotwife Francesca Le welcomes the young cutie with kissing and groping. The busty MILF eats and rims Alexis, warming her up for a threesome. Francesca's husband, Mark Wood, arrives to provide the meat. Alexis gives the married stud a spit-soaked blowjob, sliding her tongue under his shaft as he fucks her throat. Lewd Alexis eats his asshole! She spreads her legs on the bed, whimpering when Mark's hard-on enters her pussy. Things ramp up when Mark's meat drills into her rectum. Francesca films the intense sodomy session, taking breaks at various points to jump into the fun. The camera captures multiple close-up views of Alexis' immensely gaping anus. Both babes enjoy vigorous anal reaming. The freaky encounter includes graphic, ass-to-mouth cocksucking and hard-riding sodomy. Alexis takes a massive cum facial.

Evil Angel - Natalie Brooks - Rim Job, Bj & Fuck Fun

File: bp2nunaevannatbroeshbtbeoha.mp4
Size: 1.73 GB
Duration: 40:18
Resolution: 1920x1080
Format: mp4
Description: Hot, leggy babe Natalie Brooks stuns in plaid schoolgirl miniskirt and soft, white blouse with matching stockings. She pulls up the uniform to show off her black, studded panties. The dark-haired, dark-eyed doll teases slowly, flaunting her delectable butt. She uncovers her chest, revealing natural tits. Natalie exchanges some friendly repartee with performerco-director Mick Blue as his intimate camera work puts her scrumptious body practically in the viewer's face. She masturbates for the pervy filmmaker and the audience. Mick eats her juicy pussy. He drives his big cock deeply into her slit while she breathlessly rubs her clit. Natalie takes a fuck ride. Mick captures a blowjob in POV-style footage. Nasty Natalie rims his asshole. They hump and pump in a variety of positions. Mick pummels her poon till he busts his load, filling her snatch with a creampie. Spunk drizzles from blissful Natalie's gooey gash.

Evil Angel - Stephanie Love - Curvy Girl's Creampie

File: krlnlnaevanstelov5vnbhxq8wx.mp4
Size: 1.71 GB
Duration: 39:49
Resolution: 1920x1080
Format: mp4
Description: Voluptuous, longhaired blonde Stephanie Love grooves through a slow tease in a white top and a plaid, pleated schoolgirl mini skirt. She flaunts her shapely, uncovered ass and reveals her big tits. Stephanie shares a brief chat with top performerdirector Mick Blue. The sultry-voiced vixen tells some dirty stories from her past. Mick's camera takes in her delectable anatomy as she exposes her bald slit. Stephanie masturbates her snatch, and then Mick feverishly fucks her! Stephanie wraps her lush, sensuous lips around Mick's big cock as he shoots the rousing blowjob from a POV angle that puts viewers practically in the scene. She shoves her tongue up his ass for a gnarly rim job. Mick slides his schlong into her pussy and bones her doggie-style. Orgasmic Stephanie wails as Mick pummels her wet slot in multiple positions. He busts his nut in her hot box. Stephanie lets Mick's creampie trickle out of her fully fucked twat.

Evil Angel - Francesca Le - Swing Debauchery Desired

File: vm14inaevanfralexesrsbedq5.mp4
Size: 1.32 GB
Duration: 30:39
Resolution: 1920x1080
Format: mp4
Description: Beautiful, oversexed MILF Francesca Le is always checking a swinger website for new, hung guys. The busty adventuress recently met a new stud on the smutty site his handle is 'Debauchery Desired,' and now they're hooking up for a freaky flesh meet! Dolled up in white lingerie, Francesca talks dirty to her new conquest, and they make out. The stud spanks her plump booty as she grinds on his lap. Francesca unbuttons his pants to unleash his massive meat. She gives a sloppy blowjob, choking and drooling over his big cock. Next, Debauchery Desired penetrates her pussy, pounding Francesca as her jumbo jugs bounce. The heated, gash-bashing encounter delivers rod riding and throat reaming fellatio. Lewd Francesca can't resist rimming her new man's bunghole. For the finale, Mr. DD jacks his joint and slathers Francesca with an epic cum facial.

Evil Angel - Francesca Le - Hotwife Cuckolds You

File: vr2z1naevanfralexd6adnmg6c.mp4
Size: 1.43 GB
Duration: 29:50
Resolution: 1920x1080
Format: mp4
Description: Fabulous, busty MILF Francesca Le loves kinky sex. The dirty-minded pornographer treats fans to a special experience In POV-style footage, you get to see what it'd be like to be gorgeous hotwife Francesca's cuckold! Tempting in a tight skirt, skimpy top and heels, she explains the dirty doings about to go down. Francesca strips and teases you with hot, dominant jerk-off encouragement. She soon welcomes stud Brock Cooper into the marital bed. The horny wife unbuttons his pants and whips out his massive boner for a choking, drooling blowjob. Brock slides his big cock into Francesca's pussy while she masturbates her clit he slam-fucks the wild woman as she moans in ecstasy. The epic affair includes loads of explicit dirty talk a spit-soaked titty fuck and rod-riding copulation. Nasty Francesca rims Brock's bunghole and worships his meat. He sprays his sperm over her wet slit. Francesca spreads open her semen-soaked pussy ... and orders her cuck YOU! to slurp up the mess!

Evil Angel - Ivy Ireland - Anal, A2m & Rim Job Study

File: l9dzwnaevanivyireakks7y91he.mp4
Size: 1.90 GB
Duration: 39:54
Resolution: 1920x1080
Format: mp4
Description: Hot-bodied Ivy Ireland teases enchantingly in her sexy schoolgirl uniform white blouse and stockings, plaid mini skirt and black heels. Ivy displays her round ass, unknots her top and shows off her small, natural tits. The heavenly brunette engages in a pre-scene chat with top pornographer Mick Blue. She masturbates with building intensity as Mick shoots intimate, POV-style footage. He slides a mammoth dildo up Ivy's rear chute, loosening the hottie's butthole for anal fucking. She massages her clit while Mick's big cock invades her rectum. Ivy gives him an ass-to-mouth blowjob, and she rims Mick, eating his sphincter. He fucks her pussy doggie-style amid an all-holes workout. The aroused, tasty beauty plays in multiple positions. This session climaxes with Mick stroking a copious load of spunk onto Ivy's tongue. 'Thank you for using my holes,' she says with a wide smile as pearly cream drips from her chin.

Evil Angel - Francesca Le - Buttfucked By An Agent

File: zmkpsnaevanfralebu4zxjo7nq.mp4
Size: 2.46 GB
Duration: 38:12
Resolution: 1920x1080
Format: mp4
Description: Nasty porn director and spectacular MILF performer Francesca Le stuns in a tight, revealing outfit, eagerly waiting for her female co-star to arrive till young talent agent Conor Coxxx informs her that the girl can't be found. But frustrated Francesca needs sex! Conor volunteers to service the horny lady, and she can't resist. They make out, Francesca stroking his dick through his jeans. She yanks off his pants to give a slobbering blowjob.

Francesca hops onto his lap and slides his big cock between her plump butt cheeks. She whimpers when Conor stuffs his boner into her pussy. Francesca rides rod and talks dirty through an epic affair. The action escalates to intense anal reaming with sloppy, ass-to-mouth fellatio lewd rectal gaping and a creamy cum facial. Francesca uses Conor's prick to scoop excess semen from her face, swallowing the juice. She confessing to Conor, 'You're the best agent ever!'

Evil Angel - Scarlet Chase - Tight Squeeze Gets Double Dipped

File: m6saanaevanscachaelapqfagtl.mp4
Size: 1.74 GB
Duration: 28:12
Resolution: 1920x1080
Format: mp4
Description: This scene premieres exclusively on EvilAngel.com! Athletic beauty Scarlet Chase stuns in a revealing fishnet outfit, shaking her plump booty through a hot opening tease. The busty goddess strips off the few threads she's wearing. Anticipating intense sodomy, she fondles her pussy and crams anal beads into her butthole. Scarlet greets Elic Chase with a drooling blowjob. The insatiable vixen continues to masturbate while taking brief breaks to suck Elic's meat pole. Scarlet soon finds herself bent over on the couch, eager for intensified 'full-fill-ment.' With a sex toy stuffing her sphincter, Elic fucks her twat. Then he buttfucks Scarlet while the toy is still inside her rectum, a dickdildo double-anal stuffing! She rides Elic's rod and enjoys a serious backdoor bang, pausing at points to give slobbering, ass-to-mouth head. Freaky, no-holes-barred action includes nasty farting and a creamy climax Scarlet slurps Elic's dick until he ejaculates into her mouth, savoring his milky sperm and swallowing it down!

Evil Angel - Francesca Le - Wife Swings For Big Cock

File: blyoynaevanfraleaizx7pwkcn.mp4
Size: 1.46 GB
Duration: 33:03
Resolution: 1920x1080
Format: mp4
Description: Married pornographers Francesca Le and Mark Wood are very active in the swinging community. In this scene, Mark films his busty hotwife with young, hung stud Parker Ambrose. The tan MILF can barely contain herself in the opening moments, grabbing his big cock through his jeans while they passionately make out. Francesca unleashes his massive meat from his pants and gives him a nasty, worshipful blowjob with ball lapping. She talks dirty whenever his thick prick pulls out of her mouth, and she moans when he stuffs his boner into her pussy. Francesca spanks her plump booty while feverishly riding dick, begging Parker to pound her harder throughout. The freaky, extramarital session includes a slippery titty fuck slit-slamming copulation and an orgasmic climax Parker blasts a cum facial over Francesca's open mouth she scoops up excess semen and swallows it down!

Evil Angel - Nelly Kent - Busty Wife's Anal Gaping

File: 13bylnaevannelkentqybbshhya.mp4
Size: 1.45 GB
Duration: 33:46
Resolution: 1920x1080
Format: mp4
Description: Busty brunette starlet Nelly Kent and pornographer David Perry portray a married couple. Nelly sports waist-length hair and a delicate frame she wears a dress. David fondles the slender, sexy doll. She strips down to stunning, bright-red lingerie. The petite lady removes her top, revealing big boobs for David to slurp. Nelly gives him a skillful blowjob. She bends over as he drives his boner in her pussy. Soon, David fucks her asshole. Nelly squeezes her jugs around his rod for a wild titty fuck. The loud, wonderfully foul-mouthed wife takes more anal fucking in multiple positions. David bones Nelly's butthole to gaping! She strokes his dick with two hands, begging her husband to cover her face in semen. He festoons her with a creamy cum facial. The pretty lady smiles, her faced lathered in pearly jism.

Evil Angel - Summer Vixen - Pussy Squirts, Ass Gapes

File: a3zysnaevansumvixnqiyxuiz5u.mp4
Size: 1.53 GB
Duration: 35:29
Resolution: 1920x1080
Format: mp4
Description: Slim, dirty blonde anal sex star Summer Vixen isn't shy about her addiction to depraved backdoor fucking. Dolled up in skimpy lingerie, she strips and licks her lips for the camera. While warming up her sphincter with a massive black dildo, she talks dirty and tastes her booty flavor on the colossal toy. Heavily hung stud Jovan Jordan steps in to provide what Summer needs most, pounding her hungry asshole with his humongous, big Black cock. Nasty Summer gives a slobbering, ass-to-mouth blowjob, drooling as Jovan ruthlessly fucks her throat. This epic sodomy session serves up raunchy farting, immense rectal gaping, and orgasmic Summer's squirting orgasm. Through this intense encounter, she begs Jovan to slam her harder. Finally, Summer kneels as Jovan cakes her forehead in wads of hot sperm. The cum facial climax culminates with Jovan using his dick to scoop semen into Summer's mouth, and she swallows the spunk!

Evil Angel - Jesse Pony - Glam Girl Anal Gaping & A2m

File: kzixlnaevanjesponfn1eqxsw2o.mp4
Size: 1.60 GB
Duration: 37:36
Resolution: 1920x1080
Format: mp4
Description: Glamorous, flexible, freaky beauty Jesse Pony teases in skimpy lingerie and sexy heels, posing and stripping. The vulgar vixen wears a tank top at various times throughout the intro, pointing out the lettering that reads, 'Gape Me.' With a golden butt plug wedged tightly in her rectum, Jesse shows off her fit frame, prying apart her cheeky crack to taste her flavor on the toy. She crawls to naked Rob Piper, enamored by the size of his thick big Black cock. Wild Jesse talks dirty and gives a raunchy blowjob, lewdly salivating while smacking Rob's huge, meaty boner across her face. She climbs onto his lap and rides his rod, masturbating as he sodomizes her. The backdoor bout features graphic anal gaping, a kinky foot job, and Jesse's worshipful fellatio. She gives messy, ass-to-mouth head in the climax, finally opening wide for a crude cum facial. Director Jonni Darkko recaps the ejaculation in a slow-motion instant replay.

Evil Angel - Zazie Skymm - Anal & Deepthroat Duties

File: r9ax5naevanzazskycol6fncl2q.mp4
Size: 1.92 GB
Duration: 44:52
Resolution: 1920x1080
Format: mp4
Description: Glamorous, leather-jacketed platinum blonde Zazie Skymm arrives for a housecleaning job interview with Nikki Nuttz, a married man. She lands the gig and later reports for work at his apartment. Snooping around, nosy Zazie tries on sumptuous, blue lingerie belonging to Nikki's absent wife. When Nikki catches her in the act, he seems more aroused than angry. The husband comes on to Zazie with seductive kissing and fondling. He sucks on her natural tits. She services his cock with a blowjob. Nikki licks her pussy from behind. Next, Zazie takes a doggie-style anal drilling. Indulging his foot fetish, Nikki unsnaps her heels to taste her pink-painted toes. The skillful, new housekeeper deepthroats Nikki's prick. Rectal reaming in multiple positions stretches Zazie's sphincter to gaping and leads to tasty, ass-to-mouth cocksucking. Nikki bastes her with a cum facial that soaks her tongue.

Evil Angel - Sasha Sparrow - Gaping & A2m Teacher

File: 2hrwinaevansasspay4oett5vkn.mp4
Size: 1.80 GB
Duration: 40:41
Resolution: 1920x1080
Format: mp4
Description: Breathtaking brunette Sasha Sparrow walks down the avenue in a winter coat and a black mini skirt. At her office, the bespectacled teacher greets rugged stud Lorenzo Viota for a Russian language lesson. Slowly, the aroused educator comes on to the student, eventually peeling off her panties to masturbate. Lorenzo inhales her undies as she rubs her snatch. He pulls off her bra and licks her pierced nipples. Lorenzo eats her pussy, and Sasha gives him a stupendous, deepthroat blowjob! He shoves his dick up her ass. Sasha responds with ass-to-mouth cocksucking. The muscular dude pounds her butthole doggie-style. Sasha's slam-fucked sphincter gapes! The intense anal lesson climaxes as Lorenzo ejaculates a load of semen onto Sasha's clear glass desktop. The doll orally cleans his meat, scoops up his spunk and lets it drip off her fingertips and down her throat!

Evil Angel - Nichole Saphir - Gaping Anal Threesome

File: nva48naevannicsaplhwjl3wu1l.mp4
Size: 1.55 GB
Duration: 23:25
Resolution: 1920x1080
Format: mp4
Description: Nichole Saphir is a busty, tattooed blonde with big Black cock on the brain. The freaky babe puckers her pouty pink lips and teases the camera, eager to have her holes crammed. Nichole models sheer lingerie, soon finding herself spread-eagled on the couch next to big studs Hollywood Cash and Rob Piper. Hollywood hammer-fucks her butthole while she gives Rob a blowjob. Dirty-talking Nichole vigorously poses her gaping rectum, whimpering when the dudes take turns fucking her asshole. Nichole's rough anal threesome delivers sloppy, ass-to-mouth fellatio and greasy, hole-stretching sodomy. She drops to her knees for a messy cocksucking finale. Hollywood and Rob reward her with two creamy cum facials. Cute face coated in hot semen, Nichole says, 'You guys can come and fuck this little asshole anytime you want!'

Evil Angel - Leya Desantis - Ass Gaping, Pussy Squirt

File: swi1xnaevanleydes1hqcm1dlxp.mp4
Size: 1.72 GB
Duration: 41:09
Resolution: 1920x1080
Format: mp4
Description: Exquisite redhead Leya Desantis reclines in sexy black heels, stockings and lingerie. Fair-skinned Leya calls repairman David Perry over to inspect her bathtub. David's busy working as she enters, strips and gets into the tub. Stunned David succumbs to her seductive ways, letting her suck his cock. He slips his schlong up her slippery cunt. Leya's natural tits jiggle as her shaved slit massages his meat. David tongues her butthole in a pervy rim job.

Leya takes a doggie-style anal reaming. The repairman drills her flowering, pink asshole to gaping! Leya tastes her backdoor flavor with an ass-to-mouth blowjob. And he fingers her twat to a squirting orgasm! David poles her holes relentlessly. The crimson-haired babe strokes his flesh rod until he spews his foamy nut onto her pierced tongue. Sticky-chinned Leya plays with his sperm, drooling it onto her boobs.

Evil Angel - Chloe Amour - Huge-cock Sodomy & Gaping

File: svnq2naevanchlamov6izz8dbeg.mp4
Size: 1.67 GB
Duration: 30:28
Resolution: 1920x1080
Format: mp4
Description: Scorching porn star Chloe Amour requires an exceptionally hung man to properly satiate her anal needs. The tan, leggy vixen shows off her luscious body in luxurious lingerie, stripping and posing through a glamorous tease intro. Chloe soon meets mega-stud Anton Harden. She strokes his big Black cock to warm him up. Chloe chokes as she gives a blowjob, using two hands to stroke Anton's massive meat while simultaneously sucking. Nasty face fucking flows into intense anal reaming with immense rectal gaping. Chloe pries apart her cheeks to give Anton the perfect target, whimpering while he ruthlessly rails her rectum. Hole-stretching sodomy comes with dirty talk, passionate kissing and slobbering, ass-to-mouth fellatio. For the climax, Chloe opens wide while Anton slathers her in hot sperm. Now covered in a creamy cum facial, Chloe blows a kiss to the camera.

Evil Angel - Angel Youngs - Airtight Angels

File: iau5bnaevanangyoun6m9bxovne.mp4
Size: 2.45 GB
Duration: 39:13
Resolution: 1920x1080
Format: mp4
Description: Breathtaking blonde bombshell Angel Youngs teases in colorful bikini attire. She lets her big tits flop out. Swinging dicks Richard Mann, Chocolate God and Vince Karter surround the tall knockout. Vince fucks her in the ass while she sucks Richard and Chocolate God's big Black cocks. She gives Chocolate God and Vince drooling blowjobs while Richard's huge pole packs her butthole. Vince rails her rectum while Chocolate God crams her pussy in a torrid double penetration! Next, Richard pounds her twat as Vince reams her bunghole with more DP slamming. Angel moans loudly as Vince's big cock stretches her sphincter. She enjoys multiple rounds of feverish oral, vaginal and anal drilling. The guys simultaneously cram her mouth, cunt and cornhole, rendering insatiable Angel airtight! The carnal foursome builds to a climax as the hung dudes dick-slap Angel's pretty face. They take turns draining their loads, first on her pierced tongue, then with a glorious cum facial soaking!

Evil Angel - Maddy May - Pussy Squirting, Anal Gaping

File: ooacnnaevanmadmayv7dh2jyiyx.mp4
Size: 1.23 GB
Duration: 28:48
Resolution: 1920x1080
Format: mp4
Description: Chic, tattooed Maddy May flaunts her round booty in front of the mirror through a sexy opening tease. Geeked for intense buttfucking, the busty, bespectacled porn star models purple lingerie with a colorful pair of high-heeled boots. Maddy fingers her wet, well-groomed gash and shows off her luscious tits to start. She uses a dildo to stretch her anus for aggressive stud Zac Wild's big cock. Zac oils up her plump rump, and his throbbing rod quickly penetrates her rectum. He chokes her and rudely sodomizes her, with Maddy encouraging him on to go harder. The wild babe gives a deepthroat, ass-to-mouth blowjob, pulling her lips from Zac's prick to taste his slobber when he spits on her. She laps his balls and talks dirty, lewdly drooling when she rides dick. This lewd anal affair delivers harsh pussy pounding, backdoor gaping, and Maddy's intense, squirting orgasm! For the finale, Maddy begs Zac to cover her in semen, and he obliges with a massive cum facial.

Evil Angel - Summer Vixen - Squirting Plus Anal Gaping

File: sdwnwnaevansumvixaj5pxc8wsp.mp4
Size: 2.01 GB
Duration: 38:54
Resolution: 1920x1080
Format: mp4
Description: Dirty blonde star Summer Vixen is always down for some nasty anal sex. The trim adventuress teases in lingerie to open things up, spreading her butt cheeks to show off her open asshole. Summer lubes herself up and jams a giant dildo into her booty as preparation for stud Vince Karter's massive, uncut meat. She gives him a sloppy blowjob when he arrives, drooling and choking herself while Vince roughly fucks her face. Intense oral action leads to serious slit slamming, with dominant Vince spitting in Summer's face while he hammers her pussy. He jams his fingers into her twat while sodomizing her, and then shoves Summer's toy into her gash for dickdildo double penetration! Extreme hardcore fun features rectal reaming and anal gaping. Aroused Summer rims Vince, and she blasts multiple squirting orgasms! She savors hot semen, milking every drop of spunk from Vince's schlong.