pornbly.com
loading...
Loading image...
X
^
X
Loading image...
Home
X
Go Premium
Page#
4

Massage Rooms - Cindy Shine - Husband Cheating With Sexy Masseuse

File: xcftvnamarocinshiduseqmtqdw.mp4
Size: 899.65 MB
Duration: 22:45
Resolution: 1920x1080
Format: mp4
Description: Its Brad Knights first time visiting sexy masseuse Cindy Shine, who strips the beefy hunk naked and gently rubs oil all over his muscular chest. While giving Brad a sensual massage, the hot brunette flashes her small, perky tits before sucking on her client's throbbing erection and lubing it up. Following a sensational handjob, the petite stunner eases her hairy pussy down on Brads rock-hard dick and rides him cowgirl and reverse while stroking her clit, moaning loudly as she strokes her clit to orgasm. Afterwards, the horny pair have a sexy side fuck on the floor, and then Cindy spreads her legs and invites the tattooed stud to eat her out before taking a missionary-style pounding. When its time to cum, Brad pulls out in time to shower the petite babes hot body in his juices!

Bratty Milf - Armani Black - Stepmom Gets A Full Body Massage

File: xevaqnabrmiarmblaoft6i3ykzx.mp4
Size: 2.52 GB
Duration: 28:17
Resolution: 1920x1080
Format: mp4
Description: Parker Ambrose is hanging out outside when his stepmom Armani Black joins him. She tells him that she's had a super stressful day and that she needs to cash in on a previous promise he made to give her a massage whenever she wanted. Parker reluctantly agrees, so Armani goes inside to get ready.

When Armani enters Parker's bedroom, she's not wearing anything at all once she drops her towel. Parker tries to protest, but Armani swears his dad will never find out. That satisfies Parker enough to go ahead and cover his bigtit stepmom in massage oil. He begins, trying to keep his hands in the safe zone. That lasts all of a few seconds until Armani insists that he should give it to her pussy.

Now that Armani has gotten her stepson where she wants him, she turns the tables on him. Popping his hardon out, she sucks him down and then climbs aboard to arch her back and ride him in cowgirl. Turning around, Armani lets Parker get handsy with that ass as she rides in reverse cowgirl. They move on to Armani enjoying Parker's cock between her thighs as she splays herself out on her back. Then she enjoys a doggy style dicking down as he finishes her off. When Armani is feeling better, she gets on her knees so Parker can finish himself off and give her a facial.

Massage Sins - Jenny Doll - Hot Girl Gets Massaged And Fucked

File: rqlhanamasijendolx1goxyegfv.mp4
Size: 3.12 GB
Duration: 43:45
Resolution: 1920x1080
Format: mp4
Description: We all love to watch erotic massages that lead to a happy end, which is the main niche of MassageSins.com. If you are in the mood to watch gorgeous girls give hot oily massages to handsome hunks and other stunnin beauties, you have come to the right place. In this section of Adult Prime, you get to see lots of high-quality content coming from MassageSins. Here, its all about giving the most erotic and sensual massages and high-quality videos.

Shady Spa - Agatha Delicious - No Title

File: angvgnashspagadelvapv9nbkfa.mp4
Size: 445.00 MB
Duration: 14:51
Resolution: 1920x1080
Format: mp4
Description: Today is Agathas first day at this spa, but she had no idea she is allowed to give her clients a happy ending massage. This sexy masseuse is willing to get a 5-star rating so she is going to suck her clients huge dick while massaging his balls. This is not the kind of massage you expected to get, right dude?

All Girl Massage - Aften Opal & Kylie Rocket - Massage Me Everywhere

File: clnhonaalgimaaftkylvkbn4zdrci.mp4
Size: 1008.18 MB
Duration: 32:22
Resolution: 1920x1080
Format: mp4
Description: Kylie Rocket is grateful that her masseuse, Aften Opal, was able to come over to her house. Kylie's boyfriend has been stressing her out lately, so she could REALLY use a massage. Aften says that she's happy to help.

Kylie strips down for the massage, then lies down on the massage table and covers herself with a towel. Aften gives Kylie a sensual massage, helping Kylie's tense body to relax. It's clear that Kylie has been under a lot of stress, so Aften suggests removing Kylie's towel in order to do a more thorough massage. Kylie agrees to it, and Aften massages Kylie's nude body while inviting her to talk about her troubles.

Kylie shares that she's not very happy with her boyfriend, in fact, she's so unhappy that she's beginning to think that she doesn't even like guys. Kylie feels that all of her female friends have been MUCH nicer to hang out with, so she definitely seems to prefer the company of women... could Kylie be a lesbian? Kylie wishes that she could try being with a woman to find out for sure. Luckily, Aften is happy to help with lots of things, so she kisses Kylie and leads her through a pleasurable lesbian sex session.

Nuru Massage - Vanna Bardot - Surprise Get Naked!

File: xq73unanumavanbarl5etgdhuwj.mp4
Size: 1.62 GB
Duration: 43:51
Resolution: 1920x1080
Format: mp4
Description: It's Chad Alva's birthday, and his parent has decided to get him a very special present. In fact, she's gotten him a massage for his sore back. But this isn't just ANY massage, she's gotten Chad a NURU massage. Chad's never heard of it, but his back has DEFINITELY been killing him, so he graciously accepts.

A few days later, Chad shows up at the parlor and meets his masseuse, Vanna Bardot. Chad explains that he hurt his back playing lacrosse. Vanna explains that although NURU isn't technically a therapeutic-style massage, it will certainly make him feel A LOT better.

And when Chad finally gets naked and onto the mat, he can definitely see why. It feels fantastic, and the sensations he's getting from Vanna's naked body sliding over him are hard not to enjoy. In fact, it seems like he's enjoying himself a BIT more than he expected when he and Vanna notice that his cock is rock-hard. Vanna's turned on, and decides to give Chad an EXTRA treat. After all, it isn't a 'happy birthday' without a happy ending!

Bangbros Clips - Alyssa Bounty - Working The Tight Areas

File: yvlydnabaclalybouse31jbgab8.mp4
Size: 3.34 GB
Duration: 47:34
Resolution: 1920x1080
Format: mp4
Description: Alyssa Bounty thought all she was getting was a massage. That was until she got naked. Erik could not help but really get into her tight areas. She could see he was visibly hard and decided to do a little rubbing of her own. He assured her it wouldn't be extra if she wanted to put it in her mouth. He also let her know that he offers an even deeper tissue massage to which he means anal. He really loosens her asshole up with his throbbing dick. She might be low on protein as well after this, so he made sure she swallowed a good enough amount. Hopefully she will schedule another massage next week, and recommend to her friends.

Shady Spa - Anna Kovachenko - No Title

File: p2shnnashspannkovs4spm8v1bv.mp4
Size: 439.98 MB
Duration: 14:38
Resolution: 1920x1080
Format: mp4
Description: Hot masseuse Anna cant resist touching a big hard cock. Today this sexy blonde gets turned on while massaging her new client, so she grabs his dick and starts stroking it using both hands. Anna is going to make him release, but first she will make sure he cant hold his cum anymore.

Shady Spa - Riley Shae - Riley Is Trained

File: mg7gjnashsprilsha6xkyykek37.mp4
Size: 438.92 MB
Duration: 14:39
Resolution: 1920x1080
Format: mp4
Description: Riley is trained and has studied manual release therapy, is an ancient energy healing practice, and the art of healing using life force energy to improve the flow of energy that may be blocked or is in a state of imbalance. In her down tome you can find Riley working our and meeting new friends.

Blacks On Blondes - Chanel Camryn - Getting A Nice Massage

File: d1x8vnablonblchacam3iaj5wrbw5.mp4
Size: 2.93 GB
Duration: 41:18
Resolution: 1920x1080
Format: mp4
Description: There is nothing more relaxing than getting a nice massage. Letting all your troubles and aches and pains ebb away as the professional masseuse lets her fingers do their magic. In the case of this little masseuse Chanel, she can get quite excited rubbing down the bodies of these big sexy muscular men that come in for massage treatments. Gets her little pussy all gooey and messy as she slides her fingers over their bodies. Especially the black men. It's something about these big hulking black men that can just get a little white girls pussy all up in a twitch...

So today when client Mr Sudan rolls over onto his back she just has to see what that lump under the sheet looks like. Oh yes indeed that is one big black cock just begging for the happy ending treatment. Chanel just can't help herself as she jerks that big cock nice and hard so she can shove it into her mouth. Who is to say what thoughts are racing through the mind of our lucky client as his manhood is being engulfed by this horny little white girl. She has a drippy soppy pussy that is just begging to get stuffed so he does what he does and lays some pipe into our writhing horny masseuse. Ahhh now this is how a massage is supposed to go. He fills her drippy pussy up with a nice heaping of man juice.

Porn World - Kiara Lord & Lenina Crowne - Ravishing Redheads Share Masseuse's Cock

File: 1jazqnapowokialengr9xcw3oqi.mp4
Size: 4.48 GB
Duration: 01:21:25
Resolution: 1920x1080
Format: mp4
Description: Redhead babes Kiara Lord and Lenina Crowne are enjoying some time in the health spa when their sexual tension gets all too much and they get in the pool and tease each other before stepping out to start a sensual massage. Lenina lays down on her front as stunning Kiara oils up her back and treats her to a massage. Both girls get naked and Kiara rubs her naked ass against Lenina's oiled up skin before she starts to lick her pussy! These hotties swap places and Lenina fingers and licks Kiara while bent over in the doggystyle position. They take turns to toy each others holes when their masseuse, Jay walks in on them. He decides to continue their massage in the most unique way as Lenina leans over and sucks his cock! They get all their holes drilled with his big dick and share his cum between their mouths!...

Massage Rooms - Jennifer Mendez & Arish Lamborghini - Big Tits Big Ass Oily Sex Massage

File: zc8phnamarojenariiqs6hvnrtq.mp4
Size: 866.98 MB
Duration: 21:13
Resolution: 1920x1080
Format: mp4
Description: Beautiful curvy babes Arish Lamborghini and Jennifer Mendez star in this sultry scene, where they sensually massage oil into each others gorgeous bodies amidst a romantic, candlelit backdrop. The wet, glistening lesbians grind their big boobs together and lock lips, then stunning brunette Jennifer eats out Arishs lubed-up pussy before straddling the raven-haired beauty. Following some sexy tribbing, voluptuous honey Arish pleasures Jennifer until she reaches orgasm, and then the amorous pair end the steamy session with a passionate kiss.

All Girl Massage - Lauren Phillips & Lily Larimar - Doing Something Sweet

File: ryjfnnaalgimalaulilypiay2kmsh.mp4
Size: 1.38 GB
Duration: 38:29
Resolution: 1920x1080
Format: mp4
Description: Lily Larimar arrives home with her sugar mama, Lauren Philips, after a wonderful night out. Lily is feeling grateful and wants to treat Lauren to a nice massage, which Lauren is more than happy to accept.

They are flirty and sensual as they strip each other down, caressing each other and stealing little kisses. Soon enough, Lauren is stretched out along a massage table as Lily works her divine hands all over her sexy body. Of course, just massaging Lauren isn't the ONLY thing Lily wants to do!

Tricky Masseur - Kate Love - Bright Orgasm After A Full-body Massage

File: ptxf6natrmakatlovqows6tcgxr.mp4
Size: 2.97 GB
Duration: 29:48
Resolution: 3840x2160
Format: mp4
Description: Beautiful Kate Love comes to the massage parlor to get her body massaged to help her do the dancing workouts easier. Her private dance couch tells her a full-body massage is needed to prepare her body. Kate Love takes off her clothes besides her tiny panties, lies down on the massage table, and gets ready to enjoy the masseurs strong hands caressing her naked body. Everything goes as usual, but things change when the dude goes down to her round butt. This begins the start of a passionate fuck on the massage table.

Thai Pussy Massage - Kaeo - No Title

File: s7drznathpumakaeoulnjj6pomw.mp4
Size: 849.49 MB
Duration: 22:14
Resolution: 1920x1080
Format: mp4
Description: Kaeo arrives at the massage salon and she takes the white sheet off with such sensual gestures that make her look like a goddess. She puts a pillow under her head and she waits for the masseur to start the work. He begins by massaging her boobies with oil, which she loves it because she simply adores to have her tits fondled. He goes down with his hands on her pierced belly and then back to her boobs. The masseur spreads her legs to massage every of them, but he also sticks his middle finger between her black labia and slowly fucks her while massaging her tummy. Such pleasure, relaxation and joy take hold of Kaeo!

All Girl Massage - Scarlett Sage & Savannah Bond - Housewife Needing Bolstering

File: fxkainaalgimascasav7tjpr1xaeq.mp4
Size: 1.13 GB
Duration: 35:05
Resolution: 1920x1080
Format: mp4
Description: A housewife, Savannah Bond, arrives for a massage appointment, but learns her regular masseuse is away. She explains to the substitute masseuse, Scarlett Sage, that her body is really sore. Savannah says the treatment her regular masseuse has been giving her helps temporarily, but her aches always flare up again, so she wonders if Scarlett can recommend anything different to help. Scarlett suggests a bolster massage to allow better access to Savannah's backside for Scarlett to apply her techniques.

As Scarlett leads Savannah through a bolster massage, she asks probing questions about Savannah's home life to try to better understand what could be causing her pains. Savannah says that she doesn't do anything physically exerting so she doubts her lifestyle could be the cause of anything, so maybe it's some kind of emotional stress.

Scarlett asks if Savannah has any causes of emotional strain or stress she's been holding back. Savannah admits that she's having huge second thoughts about her marriage, and after Scarlett digs deeper Savannah admits she has been questioning her sexuality for some time. She has kept it to herself for so long, it must have built up inside her. Scarlett suggests a surprising solution, a bit of lesbian sex will cure her worries! Savannah is hesitant, but once Scarlett assures her she'll feel so much better afterwards, she agrees to give it a try.

Massage Rooms - Betzz - Hold Me Close And Fuck Forever

File: thfxtnamarobetzcpotzfe6xo.mp4
Size: 1.16 GB
Duration: 29:10
Resolution: 1920x1080
Format: mp4
Description: Wearing nothing but a sexy black thong, raven-haired beauty Betzz passionately embraces and kisses her handsome lover, Lorenzo Viota, as they lie together on the floor in a romantic, candlelit setting. Aroused, the tattooed hunk penetrates Betzz in missionary position, making the slim babe moan loudly with each thrust of his huge cock. Next, Betzz straddles the muscular Frenchman while drizzling oil down her body and teasing her lover's throbbing manhood with her dripping wet pussy. Following a sensual handjob, the glistening goddess eases her lubed-up snatch down on Lorenzo's long, thick rod and rides the beefy stud in cowgirl, and then afterwards the pair enjoys an intense side fuck until Betzz gets on all fours to take a doggystyle pounding. To finish off this steamy session, Betzz sucks off Lorenzo until he erupts, then the beautiful nymph hungrily laps up his juices!

Massage Rooms - Chloe Chevalier & Crystal Cherry - Hot Goth Girl Thrills French Teen

File: afhqlnamarochlcryaz8wdhqjxt.mp4
Size: 989.53 MB
Duration: 26:48
Resolution: 1920x1080
Format: mp4
Description: Tattooed babe Crystal Cherry invites Chloe Chevalier to lie face down on the floor, where Crystal soothes the voluptuous blondes naked body with a hot stone massage. After grinding her pussy on Chloes juicy bubble butt, the petite goth drizzles oil over her clients sexy curves before spreading her legs and eating her out. With her small, perky tits on display, pierced nympho Crystal sits on Chloes face for a tongue fucking, then she returns the favour by pleasuring Chloe with a vibrating sex toy and treating her to an intense fingering. Next, raven-haired Crystal masturbates while Chloe tribs her pussy on her thigh, then the beautiful French lesbians fuck each other to orgasm with a double ended dildo!

All Girl Massage - Aften Opal & Kylie Rocket - Learning New Techniques

File: 1hqfgnaalgimaaftkylkicdmcqqqk.mp4
Size: 1.24 GB
Duration: 36:28
Resolution: 1920x1080
Format: mp4
Description: Kylie Rocket is relaxing at home when her roommate, Aften Opal, returns. As they catch up on their day, Kylie notices that Aften's shoulders seem stiff. That's when Kylie reveals that she just got accepted into a massage therapy school, so now's the perfect chance to get some practice in.

Kylie begins by massaging Aften's shoulders, her hands gradually working slowly down her back. As Aften removes her clothes, bit by bit, the massage starts to take a more sensual turn. It isn't long before Kylie wants to do MORE than just massage. Lucky for her, Aften is delighted to help practice happy endings, too!

Massage Rooms - Venera Maxima - Big Tits Babe Has Big Dick Orgasm

File: hwgpmnamarovenmaxga3cgsbfba.mp4
Size: 973.02 MB
Duration: 25:08
Resolution: 1920x1080
Format: mp4
Description: Glistening goddess Venera Maxima enjoys a solo session in the sauna before approaching Kristof Cale. The busty babe drizzles oil over Kristof's throbbing erection and gives him a sensual rubdown before climbing on top and teasing his dick with her tight ass. Finally, the Ukrainian beauty moves down and treats the horny stud to a sexy blowjob, and afterwards she slides his thick cock deep inside her pussy and rides it cowgirl. Next, the amorous pair engage in an intense side fuck on the massage table as Kristof plays with Veneras big boobs, then he puts the stunning brunette on all fours to give her a hard pounding from behind doggystyle. After tonguing her juicy lips and clit until she cries out in euphoria, the dark-haired hunk penetrates Venera in missionary position until he nears climax, and then he pulls out in time to spill his load all over her smokin hot body!

Nuru Massage - Vanessa Sky & Katie Kush - What're You Two Up To

File: xmvlgnanumavankatahitvjcips.mp4
Size: 388.02 MB
Duration: 33:05
Resolution: 1280x720
Format: mp4
Description: Seth Gamble is in the middle of getting his regular massage by his regular masseuse, Katie Kush... but there is NOTHING regular about their forbidden and ongoing sexual relationship! Things are already hot and heavy as Katie pours gel all over them, erotically rubbing their naked bodies together while obviously aiming for a very happy ending.

But suddenly, they are walked in on by Katie's coworker, Vanessa Sky! Katie and Seth quickly part before they're caught in the act, but Vanessa is startled to see them both naked and immediately grows suspicious. Katie has to think on the fly and claims that she's giving Seth a nuru massage, although this only makes Vanessa even MORE suspicious since had no idea that they offered such a massage at the parlor. That's when Vanessa asks to be shown exactly what a nuru massage is.

Both Katie and Seth are a little nervous but have to go along with it to try and keep their tryst from being uncovered. Katie then focuses on giving Seth a sensual nuru massage under Vanessa's watchful eye, and although Katie and Seth try to avoid being sexual, the chemistry between them is obvious. In fact, it's so obvious that Vanessa can't help but get aroused by their intimate interactions... which finally leads to her calling them out.

There's a moment of tension before Vanessa playfully insists that she won't tell on them IF they let her join the fun!

Reality Junkies - Lumi Ray - One Last

File: rcb6ynarejulumrayfp3j4fujhe.mp4
Size: 1.10 GB
Duration: 32:30
Resolution: 1920x1080
Format: mp4
Description: Awkward little hottie, Lumi Ray, is extra nervous when stud, Ryan Mclane, shows up for a massage. She suddenly has no clue what she is doing! She resorts to one last technique to relax him. Seducing him with her tight body, she fucks him on the massage table. Get ready for smoking hot sex!! A full body rubdown that will leave you cumming harder than ever!

All Girl Massage - Liv Revamped & Siri Dahl - Make It Slow

File: gya58naalgimalivsirpeofpj7ct8.mp4
Size: 1.44 GB
Duration: 42:13
Resolution: 1920x1080
Format: mp4
Description: Siri Dahl's been working really hard lately, so she's quite excited to be able to get a massage from her good friend Liv Revamped. Liv's been training to be a masseuse, so she's not technically certified, but she'll jump on whatever chance to practice that she can get. And practice is easy when it's with a friend, isn't it?

Siri's been dealing with so much stress lately. She has a tough job in finance riddled with long hours and annoying clients. She's been feeling it throughout her entire body, from her shoulders to her toes. Liv tells her not to worry- she'll make sure Siri feels as good as new once she's done with her. She instructs Siri to disrobe and lie down naked on the massage table.

Liv starts oiling up Siri's back, running her hands down to her juicy ass, nice and slow. Within moments, though, it becomes hard to ignore just how perfect Siri's body is, and Liv finds herself struggling to remain professional. To her surprise, Siri seems to be feeling just as aroused as she is. Before long, Siri and Liv take their friendship to new heights, having sensual and intimate sex together.